CAZyme Information: MGYG000003252_02259

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_02259
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
880	MGYG000003252_202|CGC2	100846.78	6.0759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 42375; End: 45017 Strand: +

Full Sequence      

MTPLISNAPTMMINLTGKKAQIACGLLCCCSMAYAQSNDNSEVLTLHTGWEFSQVGTEVW
RTAVVPGTVHQDLIHHNLIPNPFYGTNEQKIQWIENEDWEYRTAFTITADQLKRDDAQLT
FEGLDTYADVYLNGALLLKADNMFVGYTIPVKQYLRSGENLLHIYFHSPIRQTLPQYASN
GFNYPADNDHHEKHLSVFSRKAPYSYGWDWGIRMVTSGVWRPVTIRFYDAASISDYHVKQ
LSLTDQVAKLSNELEINNILPHPLQAEIKIKTSLEGEQESAITQTVTLQPGINHICIPTE
VLSPVRWMPNGWGAPTLYDFSAQVIAQGNVVAEQSHRIGLRTVRLVNEKDADGESFYFEV
NGIPMFAKGANYIPQDALLTNVTTERYQTLFRDIKEANMNVIRVWGGGTYEDDRFYNLAD
ENGILVWQDFMFACTPYPSDPTFLKRVEEEACYNIRRLRNHPSLAMWCGNNEILEALKYW
GYQKKYTPEIYREMMTGYDKLFRELLPAKVKELDADRFYIHSSPYLANWGRPESWGIGDS
HNWGVWYGKKPFESLDTDLPRFMSEFGFQSFPEMKTIATFASPEDYEIESEVMNAHQKSS
IGNDLIRTYMERDYIVPEKFEDFVYVGLVLQGHGIRHGLEAHRRNRPYCMGTLYWQLNDS
WPVVSWSGIDYYGNWKALHYQAKRAFAPVHINPLLEGDSLCVYLLSDHLDAREKLTLEMK
LTNFAGKKAGKTVVLPSLSLPANTSQCVYRTPLITLFFPAKRPLADDLRSCFMQLTLKDK
SGHTVAETVCFFEKTKDLLLPETTITYKMKQTDGKCELTLLSPALAKDVFIEVPLQGARF
SDNFFDLLPGERKTVIITSPDIKKGEELPLRLKHIRETYN

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	33	812	4.6e-110	0.7845744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.08e-111	41	872	10	801	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	7.58e-18	802	877	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	8.42e-15	231	341	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	1.31e-12	698	797	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10340	ebgA	2.18e-12	95	472	107	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95643.1	0.0	11	880	1	882
QDH55462.1	0.0	11	880	1	870
QRM97553.1	0.0	11	880	1	870
QUT28878.1	0.0	12	880	1	869
QUT23078.1	0.0	12	880	1	869

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	0.0	36	879	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	0.0	36	879	1	838	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	0.0	36	879	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]
2JE8_A	0.0	36	879	3	840	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	0.0	36	879	3	840	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	2.48e-126	45	875	8	841	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q2TXB7	2.99e-123	46	875	9	842	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	4.18e-123	46	875	9	842	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
A2QYN2	6.76e-120	45	858	8	829	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
A1CGA8	7.24e-119	46	875	9	843	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.025816	0.672267	0.298609	0.002009	0.000832	0.000453

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_02259.