CAZyme Information: MGYG000003252_03643

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_03643
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468	MGYG000003252_341|CGC2	52842.28	6.7173

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 48139; End: 49545 Strand: -

Full Sequence      

MNIRIIAIASLLIALPVSAQKKKTVINDSNTPLHLLQPAYQGTYGDLTPEQVKKDVDRVF
AYIDKETPARVVDKNTGKQITDYTAMGEEAQLERGAFRLASYEWGVTYSALIAATEATGD
LRYMDYVQNRFRFLAEVAPHFKRVWQEKGTTDPQLLQILTPHALDDAGAVCAAMIKVRLK
DQSLPVDGLIDNYFDFIINKEYRLADGTFARNRPQHNTLWLDDMFMGIPAVARMSCYDKA
QKEKYLAEAVRQFLQFADRMFIPEKGLYRHGWVESSTDHPAFCWARANGWAMLTACELLD
VLPENYPQRGKVMDYFRAHVRGVTALQSGEGLWHQLLDRNDSYLETSATAIYVYCLAYAI
NKGWIDAIAYGPVAHLGWHAVAGKINAEGQVEGTCVGTGMAFDPAFYYYRPVNVYAAHGY
GPVLWAGAEMIRLLKNQYPQMNDSAVQYYQKKQKTTAPIFAVDTEDTK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	96	432	1.8e-90	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.15e-103	62	434	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.70e-47	102	434	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94561.1	0.0	1	468	1	468
QDH54531.1	0.0	1	468	1	468
QRM98496.1	0.0	1	468	1	468
QUT32921.1	0.0	1	468	1	468
QQR18601.1	0.0	1	468	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	2.06e-303	22	465	2	445	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	3.00e-22	216	413	163	360	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.26e-19	216	413	164	361	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
1NC5_A	3.76e-19	102	436	41	370	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.51e-18	102	436	31	360	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.06e-18	102	436	41	370	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	4.09e-17	220	431	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	5.49e-17	101	438	28	343	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000620	0.993848	0.004890	0.000197	0.000206	0.000189

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_03643.