CAZyme Information: MGYG000003252_05551

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_05551
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831		92976.49	7.0048

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 5434; End: 7929 Strand: -

Full Sequence      

MKHLVIVGILSCFSMSGFAQIYKDKTASVEDRTNDLLHRMTLEEKIDYIGGYKGFYIRGI
ERLGVPEIKLTDGPVGTHKDGKSTAYPAGVLTASTWNRELAYELGKQLGRDSRARGVHIL
LGPGVNIVRSPLCGRNFEYFTEDPYLNSQVAIGYVKGLQDQKVVATLKHYAANNQEWDRN
NVSSDIDERVLHEIYLPVYKAAIQEAGAGAVMDSYNPVNGVHATQNDYLNNQVLRKQWGF
DGIVMSDWSATYDAVGAANGGLDLEMPRAKWMNKENLIPAIKAGKVKEATINEKVKRILR
IMFRFGFFDNEQLDTSIPYNNPEAAKVALELAREGIVLLKNENGLLPLNPSKVKSVAVIG
PNANSYISGGGSSYTFPFHSVSVLDGLKNAGQDLQISYAPGVPTLTETVASAAFYTEAGS
RTKGLKAEYFDNIRLKGTPAKTVIDTIVNIGNGWHIAAENKGIPYDHCSMRWSGVVRPEK
TANYRFIVRGFDGFRLKVGTEMVINEWRDQGITTREIVLPLEAGKEYPVVLEYFANVHPV
DISFGWREDKLLFDEAVEIARKSDVAIVNIGFNESSERESNDRPFELPQYQDSLVQCITA
ANPNTVVLLNAGGNVDMSKWIDKVPALLHLWYAGQEGGTAVAEILFGKVNPSGKLPISFE
KKWEDNPAYPYYYDTDGDKRVEYKEGLFMGYRHYDISDTKPQFAFGYGLSYTTFKYSDLC
INREKGKDLAVKVRFTVKNTGKYDGAETAQVYIRPVNPKVERPYKELKGFAKHFIRKNAG
QEMEITLNKDAFSYYKTDLKDFDYDAGSYEVLVGSASDDIRLRKVIQIEKK

Enzyme Prediction     

No EC number prediction in MGYG000003252_05551.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	59	267	3.8e-67	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	8.59e-97	1	821	1	758	beta-glucosidase BglX.
COG1472	BglX	6.92e-81	62	390	57	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	3.70e-72	24	788	44	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.84e-55	336	691	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	3.63e-47	62	301	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU97387.1	0.0	1	830	1	830
QNL39690.1	0.0	1	830	2	831
QEC44741.1	0.0	1	829	1	829
AWH85765.1	0.0	1	829	1	823
AWI25185.1	0.0	18	823	16	815

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.81e-141	36	828	8	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3AC0_A	3.24e-129	36	831	9	839	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.10e-125	36	831	9	839	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	2.29e-121	31	828	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	3.44e-120	31	828	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27034	3.40e-154	34	821	3	803	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q5BFG8	5.58e-145	36	829	14	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P14002	9.89e-141	36	828	8	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
A1CA51	1.57e-137	37	830	10	831	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
Q5BA18	1.06e-133	36	830	16	831	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001947	0.716334	0.280502	0.000481	0.000397	0.000315

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_05551.