CAZyme Information: MGYG000003252_05597

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_05597
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784	MGYG000003252_552|CGC2	89820.1	8.5704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 50914; End: 53268 Strand: -

Full Sequence      

MKQKILNALLLLFCATNIFAQKEVRLKENFDFDWKFSLSDQTKYADKNYDDQAWETIQLP
HDWNIKQDFVREQGGSAAYLPEGIGWYRKTFRVPTSYKEKHISVLFDGIFMQSDVYINGK
HLGFRPYGFCSIEYDLTPHLRFNEDNVIAVRVNTTGGRPRWYAGAGIYRHAWLQVANPVH
IATYGTYITTPSVSNKKADINIVTTLKNITGKEQILTISQRIFNAERKQVAQSEKSKIAV
LPRQSADLKQEFSLNTPELWTLENPVMYEMETTVKAGSKVVDIYRTAFGVRTFKFDPNNG
FSLNGKSVKLKGVCLHQDAGSMGGAVPDRSYERRLEILKEYGCNAIRCSHNQPSTEFLDM
CDRMGFIVIDEAFDKWKSGYYGKYFDEWWQKDLENMVLRDRNHPSIVLWSIGNEVSEAWD
GSNKGIDRAKMLQDFVHKYEPSRPVTLAAQNGHQAKFAGVTDVIGYNYMEARMLSDHKKY
PERCFLVSEELPYFSGEEKNIRSYTPYNPWNIVANNDFIAGGFIWAGVDYLGESGFPSRG
WPNGLFDICMFEKPRATYHRAMWNEKPIVRIAVVDPSLDIDHGRDLWQWPKMAAHWNFPD
SYQGMIMEVRTTTNCEKVEMFLNKKSIGIQKTANYPNNTIVWYLPFRVGSVEAVGYNGNE
KVAQYQLVTSKKTSKAIITPDRIRLKADGQDLSHISIQLQDVDGNPVQTDDKLLTVTVEG
DGKFMGIDNGDLRRKKSFAGNKLKTYFGRALIIVQSTRKEGKMKVNITLEGKSEPYSLEI
QTHT

Enzyme Prediction     

No EC number prediction in MGYG000003252_05597.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	22	591	1e-120	0.5997340425531915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.62e-72	33	775	18	769	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.09e-40	34	481	48	503	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	1.26e-39	34	447	19	447	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	2.51e-29	679	771	4	96	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
pfam02836	Glyco_hydro_2_C	2.16e-26	301	531	8	246	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48869.1	0.0	10	782	4	785
QJR79164.1	0.0	11	780	1	773
QRQ58661.1	0.0	1	782	1	785
SCV06580.1	0.0	1	782	1	785
QUT25652.1	0.0	1	782	1	785

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	1.36e-168	27	771	7	767	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	2.95e-168	27	771	7	767	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	7.52e-159	29	773	5	793	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	1.82e-158	29	771	29	810	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
5T9A_A	3.59e-158	26	766	26	830	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	8.51e-178	25	771	42	838	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	3.29e-112	8	731	29	769	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	1.32e-69	29	782	7	738	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KN75	5.84e-68	25	726	26	742	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
T2KPJ7	1.47e-54	25	675	51	724	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001950	0.929526	0.067563	0.000359	0.000301	0.000274

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_05597.