CAZyme Information: MGYG000003252_06190

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_06190
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784		86084.64	6.3397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 46802; End: 49156 Strand: -

Full Sequence      

MLNRICKSLLVTAMMTGVSYSFAQQLPTIIYKNPTLPVEVRVADLLSRMTLEEKVGQLLC
PLGWEMYEIKGDSVSPSDKFKQLMKERHAGMLWATYRADPWTKKTLENGLNPALAAQAGN
ALQKYVMENTRLGIPLFLAEEAPHGHMAIGATVFPTGIGMAATWSPQLINEIGKTIGIEI
RLQGGHISYGPVLDLTRDPRWSRVEETFGEDPVLTGTIGKAMVEGLGGGNLSQPYSTLAT
LKHFLAYGISESGQNGNPSFVGIRELHENFLPPFRQAIDAGALSVMTSYNSMDGIPCTAN
HYLLTELLKNEWKFKGFVVSDLYSIEGIHQSHFVAPTMEEAAVMALSAGVDVDLGGDAYM
NIINAVNTGRISNAVLDASVVRVLRLKFEMGLFENPYVVPEKAEKEVRNDAHIALARKVA
QASITLLKNDCSLLPLNKNISKVALIGPNADNRYNMLGDYTAPQEEENVKTVLDGIRTKL
SPLQVEYVKGCSIRDTLACDIKRAVAAAQRSEVIIAVVGGSSARDFKTSYKETGAAIADE
KTVSDMECGEGFDRATLSLLGRQQELLKALKATGKPLIVVYIEGRPLDKTWASENADALL
TAYYPGQEGGNAIADVLFGDYNPAGRLPLTVPRSVGQIPIYYNKKAPQNHDYVELSASPL
YAFGYGLSYTTFEYSDLRVSAISPHSFEVSFKVRNTGKYDGEEVSQLYLRDEYASVVQPL
KQLKHFERFYLKRGAVKEVKFVLSESDFALIDRNLKTVVEPGTFQVMAGAASDDIRLQTK
VVVR

Enzyme Prediction     

No EC number prediction in MGYG000003252_06190.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	127	354	2.4e-71	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	2	779	1	761	beta-glucosidase BglX.
COG1472	BglX	1.12e-94	49	479	1	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	5.29e-90	131	743	78	742	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.38e-79	50	386	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	9.18e-70	424	669	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94137.1	0.0	1	784	1	783
QRN02118.1	0.0	15	784	1	769
QNL40717.1	0.0	1	784	1	783
QNL37005.1	0.0	22	783	20	781
QGT74048.1	0.0	26	783	26	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	8.69e-146	31	776	7	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	6.76e-145	31	776	7	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	5.08e-143	31	776	36	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	1.20e-135	42	772	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	6.61e-135	42	772	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	4.10e-139	17	776	8	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	8.10e-139	17	776	8	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	2.95e-129	129	776	60	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.55e-127	31	776	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q23892	3.50e-91	42	778	80	821	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000570	0.998593	0.000226	0.000215	0.000201	0.000186

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_06190.