CAZyme Information: MGYG000003253_01937

Basic Information

• Species: HGM11417 sp900761895
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; HGM11417; HGM11417; HGM11417 sp900761895
• CAZyme ID: MGYG000003253_01937
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1010	MGYG000003253_189|CGC1	109614.3	4.3034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003253	2635273	MAG	United States	North America

• Gene Location: Start: 1510; End: 4542 Strand: -

Full Sequence      

MNQYIRKRPLLAALVLGLILSLAGALADVGAVHAADDPTVSQFLSTFQAARGTVQMSGDE
LVYTLGGENSYVQVSTEGYASGSQWYVEYLTVRNTVALRLKNQTGAESAELWFKTRTKDW
SSERKVTFDLETDGEYHMYLINLSENAGATGVLTGLRLVPKASAGTLSLDHISFERESEV
YDYAGEIISCTADGYSVTVRGTLGSAYSGQTVSLYRTDVSNMLESLDGLEPVAEVKATGT
DFTLQIPYHDGEVTMLSSSFLAAVNGVKVGHMFSVENWRDFSENPYEFELPSLTVSAADY
GAAGDSFTDDTAAIQSAIDDVSRRGGGTVVVEGDPELPYGRRYVVTSVWMKDNVELCIEE
GAVLWQSWRESDYFYPVYKGHDMEGITWGHNGLAMNYPLIYGNQADNIKITGGGTIRLLD
VGSTSRTNMYSGNYSAYCRSLIHLVPIGLYNSTNVEVSDIKILRTNCYHMVVYSCENVYI
GNVTMTEDNCLSGDGISIGAGSKNVVIDRCMLYTNDDAIVLVAQSIAEPRGVTWWKAKPD
GGDNRLQNITLRHSAVTPGNIIVLITWGVDASDLTWQTISGIEIYDNILGANLYNSACMN
LCPGQGDPYGAVGKSVPVYHVRMFDNSYRGTVSNLSAMVKHDWIVDSDGVDVVSSFVDPD
FEQKLAYWEYSGEYLEDVSSSAGAAVLSGAGSGVWQGLELAAGSHTFRASIRTENGASAR
LFAKDGLTGEILAEETVQAADGASAVLSFELPARGVCLLGAENTAEGTVYFSSPSISTSA
RSDAWFAEDFEGDSLRLRARGWNFSTWESTGVLAMEDGMFGKLELLESYGDFDFKCDFMV
QENNVSKSGAGGISLEFRRSDSGCYRVRYDAAAGALLLERDKDELTVLAQAELKLKNQAW
YQLGLRVTGGSIEVYLDGERVMSAQDEAPLRAGEASLSCLYLKTQADNLEMAAVNTLSFA
RSANWSEGQGEEEQPPRTDEPGCGGCGSAQGAWFALLCAFACIFAVRRRP

Enzyme Prediction     

No EC number prediction in MGYG000003253_01937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	394	588	6.4e-20	0.46153846153846156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.54e-26	295	521	83	314	Polygalacturonase [Carbohydrate transport and metabolism].
pfam12708	Pectate_lyase_3	1.46e-06	295	347	2	48	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
pfam06439	DUF1080	2.76e-04	790	929	6	151	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.
pfam13229	Beta_helix	0.006	400	510	18	132	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23464.1	1.97e-126	47	712	80	745
QCD41820.1	2.13e-95	72	705	236	873
ADB48561.1	1.67e-36	293	729	28	455
QGQ94767.1	7.80e-29	293	769	37	514
ADB48560.1	2.99e-28	293	749	28	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	2.05e-09	287	532	20	276	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
4MXN_A	2.01e-06	298	472	25	184	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]
2UVE_A	3.42e-06	228	523	119	409	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RY29	1.32e-07	294	562	67	336	Polygalacturonase ADPG2 OS=Arabidopsis thaliana OX=3702 GN=ADPG2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000533	0.998450	0.000234	0.000332	0.000214	0.000186

TMHMM  Annotations     

start	end
13	35