CAZyme Information: MGYG000003254_00459

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A
• CAZyme ID: MGYG000003254_00459
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798		90572.07	5.4797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003254	1848256	MAG	United States	North America

• Gene Location: Start: 129; End: 2525 Strand: +

Full Sequence      

MKRFLPIVLALFLVQTLDVRAQTNLPGYRQDDISRKWSDGRWNAVWISVPDEPANAYGVY
HFRKKLTLGKRPERFVVHVSADNRYKLYVNGQLVSAGPARGDIYNWNFETVDLAPWLEAG
ENTLAAVVWNFAEHAPIAQISFDQTGLIIQGDTQREEIANTDGSWICRKNAAYRPHAATV
IGYYAAGACEEMDATAYPWGWERPDYDDSDWQAARPGIMGAAKGARDYPGRMLVPSPIPP
MENRMRRLSRICRDGGLTLPENFPAEKSTVVVPAHTETEILLDNDSLTTAYLSLLFSGGK
GSRIAIGYAEALYVPGTAMSKGNRDETEGKNFIGYEDIVLPDGGDDRLYTTLWWRTWRYV
RLKIATGAEPLEIRDLYGTFTAYPFVRVSRFEAPGHEKLSRMLDIGWRTARLCANETYMD
CPYYEQLQYFGDTRIQAMISLYNTRDAHMVRNALEQGRQSIVADGITMSRYPSGLHQFIS
SFSLYWICTAHDYWRYRGDEAYLETLLPAFRGILSWYEKHLKDDFSLDYVPYWFFADWAS
NFEAGEPFREPDGNSAFQDLLFVTGLEAAADMEEAFGIKIYGLRYREMADAIKKTVVDKY
WDPQRGLFADTRDRRNYSQHVNVMAILTGIVEGDEARQVMVRTLEDETLTQATIYFRYYL
NQALRRAELGDKLLDNMQVWDDQLALGLSTWAEQPEPSRSDCHAWGASPNIEFFRTLLGI
DSDGPGFRTVRIAPALGGLKDASGAIPHPQGEIAVRYHVGKRGELHADISLPENVSGVFE
WHGRRYALRGGSQSLTAK

Enzyme Prediction     

No EC number prediction in MGYG000003254_00459.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	277	778	2.6e-109	0.9821428571428571
CBM67	44	215	5.1e-49	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.05e-16	396	717	10	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.26e-10	70	241	1	168	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	9.53e-09	719	776	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17167	Glyco_hydro_36	2.48e-06	484	640	129	296	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
COG3408	GDB1	6.74e-04	483	651	341	513	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA24404.1	0.0	1	798	1	798
QUT47620.1	0.0	7	798	8	807
QKH98192.1	0.0	9	796	7	803
QUT94468.1	0.0	9	796	7	803
QUT22158.1	0.0	9	796	7	803

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.13e-38	355	775	503	935	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	6.43e-27	254	755	165	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6I60_A	3.12e-11	38	777	141	894	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	6.90e-06	41	251	117	311	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	1.69e-10	30	779	123	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000244	0.999095	0.000165	0.000164	0.000153	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003254_00459.