CAZyme Information: MGYG000003255_00871

Basic Information

• Species: Muribaculum sp002473395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002473395
• CAZyme ID: MGYG000003255_00871
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		38051.12	9.1528

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003255	2196175	MAG	United States	North America

• Gene Location: Start: 3103; End: 4128 Strand: -

Full Sequence      

MTRLRYISKNYKHLNNAGNKAKTDIEIILSEDGALNAGLERTVGLGAVRGYARTLGSVIA
SCFRLKKGDVLLLQYPFKKYYDFVCRIARAKGLKTVTLIHDLGSFRRKKLTVEQEIKRLN
RNDAIIVHTPNMEKWLVENGVRVPIVILEIFDYLSEGVNTAPQSCAGDVPRVLFAGNLTF
ENNKFLYDLSEMSGNFKMVLYGNGLDKSRIGQHAVWKGFCPSDRLICEAEGDYGLVWYGV
SIVSGEGPLGEYVRYIAPHKLSLYIRCGMPVIVWKESGMAPFVAKNNIGLVVGSLEELDS
AISEVTDNQYCEMKQNVEKVSAKLASGYYTRKAVAEALKLI

Enzyme Prediction     

No EC number prediction in MGYG000003255_00871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	11	338	1.2e-93	0.984472049689441

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	4.30e-84	6	341	5	333	sugar transferase.
cd03794	GT4_WbuB-like	7.84e-13	59	339	90	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03817	GT4_UGDG-like	2.77e-05	86	226	102	271	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
COG0438	RfaB	4.52e-04	64	338	80	370	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT78203.1	1.02e-120	6	337	4	335
QUU07104.1	1.02e-120	6	337	4	335
QRP56553.1	1.02e-120	6	337	4	335
ASM65269.1	1.02e-120	6	337	4	335
QIU93766.1	6.71e-111	6	334	4	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	5.43e-16	62	338	61	326	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	2.37e-29	53	338	46	324	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
A0A0H2UR93	7.37e-19	53	338	53	330	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
B3XPQ7	3.53e-16	58	338	58	329	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
A0A0M3KKZ0	2.92e-15	62	338	59	324	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2
F8KEJ1	4.29e-15	58	338	63	334	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003255_00871.