CAZyme Information: MGYG000003255_00895

Basic Information

• Species: Muribaculum sp002473395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002473395
• CAZyme ID: MGYG000003255_00895
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	MGYG000003255_153|CGC1	29478.7	6.4862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003255	2196175	MAG	United States	North America

• Gene Location: Start: 32; End: 850 Strand: +

Full Sequence      

MDSFVDKDGKESLDGVRFLDWPTSEKPEVINSGLHSLIVMTMNAMDNLGAMAGDNELQSV
AKNCLKRVKKVKVGDCGNSQAAALIVLAAQDKKADEAAKVILANGPDGFSTFYGYYMLEA
LAKAGYHKEAQDLMSKYWGAMLDLGATSFWEDLTYSQVTDAGRIDEFVPEGKRDIHADGG
AYCYVGLRLSLCHGWASGPTPWLTKYALGIYPAEAGSKTVIVDPKPGNLTWARGTYPTPY
GPVKVDWRKGADGKIKCVVEAPAEVKVINKAK

Enzyme Prediction     

No EC number prediction in MGYG000003255_00895.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	12	266	7.6e-45	0.501984126984127

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17390	Bac_rhamnosid_C	1.20e-13	209	266	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17389	Bac_rhamnosid6H	0.002	77	151	223	310	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61840.1	1.95e-98	1	268	306	573
BBL11632.1	8.47e-93	3	268	166	431
BBL08840.1	8.47e-93	3	268	166	431
BBD46130.1	4.24e-91	9	268	329	587
BBL00915.1	5.83e-91	3	268	321	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.22e-15	2	245	444	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	8.54e-14	5	267	668	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003255_00895.