CAZyme Information: MGYG000003255_01025

Basic Information

• Species: Muribaculum sp002473395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002473395
• CAZyme ID: MGYG000003255_01025
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		37666.63	5.2101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003255	2196175	MAG	United States	North America

• Gene Location: Start: 22; End: 1029 Strand: +

Full Sequence      

MAPAFSELAERTGKHDGQMRQVINPRNLDDAGSMCGAFMRTQMADPTLKLQPEIERYWQV
CETAPIHLADGTIARNRPYLNSVWLDDMFMGLPTMAVRSAYEKNPKLLDDAASIAEGFFK
RMWVPEKGFFRHGYVEGVTPQPTFPWARANGWAILTMSQLLDFMPENHPKRQLILDTFRA
HAKTLAELQSKNGFWHQLLDRNDTFEETSATAIFTYCLAHGINQGWLDARAFGPTAQLGW
EALTTKITPEGEIEDIVVGTGMGFDPAYYSFRPVSTKAAHGYGPAIWAGAEMAKLIESSH
PYQNDSAILYYNVDPEAETPIFSLDENQKAQNVLH

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	20	294	3.2e-72	0.8373493975903614

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.37e-67	25	295	69	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.69e-41	16	295	66	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD34464.1	7.79e-171	2	335	139	472
QDO69320.1	3.59e-131	1	326	139	466
ALJ61441.1	2.90e-130	1	327	139	467
QUT92984.1	2.90e-130	1	327	139	467
QUT56860.1	4.43e-125	1	328	140	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	7.90e-121	1	325	117	443	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	9.77e-27	69	299	126	371	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.24e-26	69	299	116	361	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	4.67e-21	84	298	158	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	5.70e-14	84	253	141	318	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	5.35e-26	69	299	126	371	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	9.83e-19	84	292	201	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	1.39e-18	84	297	159	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
O31521	4.19e-12	146	294	196	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003255_01025.