CAZyme Information: MGYG000003255_01092

Basic Information

• Species: Muribaculum sp002473395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002473395
• CAZyme ID: MGYG000003255_01092
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		37083.82	5.667

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003255	2196175	MAG	United States	North America

• Gene Location: Start: 12135; End: 13118 Strand: -

Full Sequence      

MGVYAMEQGKHVAIEVPAAMNLDEIWSLIETSEKTRRHCMQLENCVYDFFEMNTLNMAQQ
GLFGEPVHVEGAYIHNLEPYWKEYHNNWRLAYNQKYRGDVYPTHGMGPACQLLDIHRGDR
MTTLVAMDSDPFTGPEVTNNVNGQQVDSFANGDHTMTMIRTANGKTIHIQHDVMNPRPYS
RMYQITGTKGFANKYPNAGYAFEPEALPEGTTPDHENLNSHRYLTDEQKAALLEKYTHPI
VREIGEMAKSVGGHGGMDFIMDYRLVYCLRNGLPLDMDVYDLAEWCSLVPLTALSIENGS
APVEVPDFTRGAWQKVKGYRHASAPEK

Enzyme Prediction     

No EC number prediction in MGYG000003255_01092.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	315	6.9e-129	0.7669172932330827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	7.76e-07	5	192	87	257	Predicted dehydrogenase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB37430.1	1.28e-195	1	327	148	476
ANU64875.2	1.28e-195	1	327	148	476
QQR08161.1	1.28e-195	1	327	148	476
QQY42903.1	9.87e-179	1	324	147	470
QQY39628.1	1.99e-178	1	324	147	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	1.71e-77	5	314	133	439	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.48e-51	2	317	108	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KX96	3.97e-179	1	324	147	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q89ZX8	1.11e-170	1	324	143	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q7MWF4	3.79e-169	1	324	144	467	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2
P0C863	3.82e-168	1	324	140	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q5LGZ0	3.82e-168	1	324	140	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003255_01092.