CAZyme Information: MGYG000003255_01317

Basic Information

• Species: Muribaculum sp002473395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002473395
• CAZyme ID: MGYG000003255_01317
• CAZy Family: GH57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		36856.85	5.7102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003255	2196175	MAG	United States	North America

• Gene Location: Start: 3118; End: 4080 Strand: -

Full Sequence      

MIYDMGYKGCITEGAKHILGWKSPDYVYAAAACPKLKLLLKNDKLSDDISFRFSNPSWEA
YPLTADKYMDWIAQTPAENQIVNLFMSLDTFGELQPRESGIFQFLEALPRFAAEKGIDFW
TPSEVVSKCKAVDTLEVLHPISWADEARDISAWLGNKLQNEAFQKLYSVSERVRLCSDRR
LKQDWQYLQGSDHFFYMSTKHMADGAAHAMFSPYETPFEAFTNYMNVLADFIVRVEEQYP
LSIENEELNSLLTTIRNQATEIEALNKEVTSMRNNLEHYNEEHALREAIKEKPEQKTDEK
KVAKKKTTVKKATKKASKTE

Enzyme Prediction     

No EC number prediction in MGYG000003255_01317.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH57	2	167	4.2e-26	0.42297650130548303

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10795	GH57N_MJA1_like	7.14e-75	1	156	154	306	N-terminal catalytic domain of a thermoactive alpha-amylase from Methanococcus jannaschii and similar proteins; glycoside hydrolase family 57 (GH57). The subfamily is represented by a thermostable alpha-amylase (MJA1, EC 3.2.1.1) encoded from the hyperthermophilic archaeon Methanococcus jannaschii locus, M J1611. MJA1 has a broad pH optimum 5.0-8.0. It exhibits extremely thermophilic alpha-amylase activity that catalyzes the hydrolysis of large sugar polymers with alpha-l,6 and alpha-l,4 linkages, and yields products including glucose polymers of 1-7 units. MJ1611 also encodes another alpha-amylase with catalytic features distinct from MJA1, which belongs to glycoside hydrolase family 13 (GH-13), and is not included here. This subfamily also includes many uncharacterized proteins found in bacteria and archaea.
COG1449	COG1449	1.24e-40	1	271	254	531	Alpha-amylase/alpha-mannosidase, GH57 family [Carbohydrate transport and metabolism].
pfam03065	Glyco_hydro_57	1.51e-21	1	137	160	292	Glycosyl hydrolase family 57. This family includes alpha-amylase (EC:3.2.1.1), 4--glucanotransferase (EC:2.4.1.-) and amylopullulanase enzymes.
cd01022	GH57N_like	6.06e-07	46	155	199	313	N-terminal catalytic domain of heat stable retaining glycoside hydrolase family 57. Glycoside hydrolase family 57(GH57) is a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). This family also includes many hypothetical proteins with uncharacterized activity and specificity. GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36161.1	7.20e-194	1	288	156	443
ANU62648.1	3.48e-167	1	288	156	443
QQR10014.1	3.48e-167	1	288	156	443
ASB36862.1	3.48e-167	1	288	156	443
QCP71895.1	2.13e-165	1	287	156	442

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59006	1.35e-57	4	237	158	398	Putative alpha-amylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1611 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003255_01317.