CAZyme Information: MGYG000003257_00220

Basic Information

• Species: CAG-631 sp000433015
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-631; CAG-631; CAG-631 sp000433015
• CAZyme ID: MGYG000003257_00220
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		43257.44	6.9854

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003257	1383591	MAG	United States	North America

• Gene Location: Start: 4634; End: 5722 Strand: -

Full Sequence      

MKKYKICVYAICKNEEKNLKGWLENVQEADKIFVLDTGSTDSSIEILKQAKENVVFQTKK
YQPFRFDEARNDSLNMVDEDCDICVCCDIDERFIKNWRKIIEKNWTADTKLLSYRYTWNF
NPDGSEGTVFFISKIHSRHDFKWVHPVHEVLQYLKKEPCKKIQLPELKLFHYADNLKSRS
SYLPLLELSVQEDPEDDRNMHYLGREYMFHKKYDEAINTLNRHLTLKSATWKDERAASYR
FIGRCQLAKNNFNEAKISYLKAICEAPYLREAYIELAYLLYEQKEYYGVIYWIEEALKIQ
DHSLTYINEAFAWNATPYDLLSLAYYFIHQKEKALEYVKKALQLSPDNERIQKNKEIFEK
MA

Enzyme Prediction     

No EC number prediction in MGYG000003257_00220.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	4.69e-11	5	172	1	164	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	4.87e-08	200	298	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	1.91e-07	236	343	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
TIGR02917	PEP_TPR_lipo	2.20e-07	202	349	95	227	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
TIGR02917	PEP_TPR_lipo	3.02e-05	167	348	537	736	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58818.1	6.29e-125	1	362	1	360
AQS58819.1	2.05e-121	1	354	1	352
ANU42689.1	2.74e-116	5	354	2	350
QQR04409.1	2.74e-116	5	354	2	350
QIA29496.1	7.80e-116	5	354	2	350

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003257_00220.