CAZyme Information: MGYG000003258_00187

Basic Information

• Species: HGM11386 sp900761915
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; HGM11386; HGM11386 sp900761915
• CAZyme ID: MGYG000003258_00187
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		45962.65	6.7461

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003258	2025539	MAG	United States	North America

• Gene Location: Start: 8178; End: 9398 Strand: -

Full Sequence      

MDRTRQRRKMHIAGLLAFLLLATAMLSLRLFDGGAASGTVNVGGMFTYETGFSAGIDVWR
KDVEIPKQFGVDINVGDTRSVSGIFRALRDIPLMLDICADIEKYCPKAVFLNYTNPMSML
CKAMQTYTKADVTGLCHSVQGTVYMLSDWLEVPAGEIDYLCAGLNHLAFYLRFERDGKSL
YPQLREKLKDPVFLNEEQVRNEMFLQLGYYCTESSGHNSEYVPWFRKRPDLLEKYCTHGT
GWNPGLYAYSLNLRIGRAAGGWRREYDEWLKKGEVDTHKSAEYASDIFNARIGDHTPFRF
NGNVLNDGCLPDLPAESCVEIPVLADRSGYRKTYVGKLPAHLAILLNTTARMENLVVEAA
MEKSREKVYRAVCFDPLTSAVCSLSEIREMTNLLFEHNSAYLGDYR

Enzyme Prediction     

No EC number prediction in MGYG000003258_00187.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	55	148	9.3e-32	0.5139664804469274

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15076	PRK15076	1.89e-141	39	405	82	430	alpha-galactosidase; Provisional
cd05297	GH4_alpha_glucosidase_galactosidase	3.08e-130	55	390	86	418	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.42e-92	55	405	89	439	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
pfam11975	Glyco_hydro_4C	1.60e-48	161	378	1	168	Family 4 glycosyl hydrolase C-terminal domain.
cd05296	GH4_P_beta_glucosidase	2.54e-47	61	402	93	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96821.1	3.09e-154	53	406	85	437
QHT62813.1	9.80e-151	53	406	85	436
ANE45532.1	2.12e-149	56	405	88	436
AEF82979.1	1.01e-146	56	405	88	437
QHW31407.1	6.17e-146	56	405	90	438

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C3M_A	2.25e-24	55	405	92	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	4.07e-22	55	405	95	440	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
3FEF_A	6.70e-20	56	377	88	420	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
7BR4_A	2.94e-15	84	395	141	470	ChainA, Alpha-glucosidase, putative [Thermotoga maritima MSB8]
6KCX_A	2.95e-15	84	395	141	471	Crystalstructure of citrate complex of alpha-glucuronidase (TM0752)from Thermotoga maritima [Thermotoga maritima MSB8],7CTD_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8],7CTL_A Chain A, Alpha-glucosidase, putative [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P06720	1.49e-71	62	402	98	445	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
O34645	1.96e-70	62	406	95	432	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
P30877	1.77e-69	62	402	98	445	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
Q9X4Y0	1.38e-56	55	405	89	442	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
I3VRU1	1.70e-29	57	406	99	462	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996663	0.003169	0.000096	0.000009	0.000006	0.000074

TMHMM  Annotations     

start	end
12	31