CAZyme Information: MGYG000003258_01333

Basic Information

• Species: HGM11386 sp900761915
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; HGM11386; HGM11386 sp900761915
• CAZyme ID: MGYG000003258_01333
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821		90782.27	7.6561

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003258	2025539	MAG	United States	North America

• Gene Location: Start: 29103; End: 31568 Strand: +

Full Sequence      

MLRRHGEWTGVREQTDTFVLEKTFRTDKTVGRAAVYATALGLYVAEINGRRVGDAYLTPG
WTSYDKTLQYQTYDVSDYVKSGENSIRITVNGGWFCGVFNGRRRTLYGRQAAALACLRIR
YEDGTDFFLATGPDWTARESVIRRSSLFDGEEWDDSRNLAPLSACRVAFGRDMLVPQQCE
PVRNIVRIPAKRRFTTPAGETVYDFGQNLTGVAEVRTTAAADGTVTLRFAEILDEKGNFY
TDNYGGAKAVDRFFARGETVFLPEFTYRGFRYMRIEGDCPPPENVTAVVRHTDMRRTGHI
VTSDARFNRLLDNVVWGLRGNFLDVPTDCPQRDERLGWTGDANVFCNTAAFLYDVRGLYG
KWLRSVRDDRDDAGRIPIVAPDVLGVKQTAALWCDSIVMTPWKLYEVYGDSSFLKDNYPA
MRQYLSACAAAAKDGLIAEGPQFGDWLALDGATPLGGNAGATDPYFIANVLYAHCLRLAA
DIADILGDGPARREYLGARAKLLSRIRSAYFTAGGRIACETVTALTLALTFDAVPPRHRA
AVAARLNERVCALRCRIPTGFAGTPYLLFALADNGYADTAGRVLMNSAFPGWLYEVDMGA
TTVWERWNGLSPDGRPHPDSRMNSFNHYAYGTVAEYVYRRVAGLDCLSPGYRKVRIAPIP
TRGLTSVRAQFDSAAGRIECGYRQEGEVLTVFATVPDNVSAEIVLPDGRSVGRGHGTFSY
RIEWPSLALPPFTRESNVGDILSNPRTAAAFTAAFSGFADVRGKKWTHSDTVGQTLDWMV
GQKELSAADGEEILRRANDTFERYARSFGKTGGRDAGGGEI

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	195	705	9.6e-156	0.9940476190476191
CBM67	13	157	6.7e-21	0.7670454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.00e-120	295	641	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.42e-46	28	183	1	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.10e-22	195	291	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	7.13e-15	643	717	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLG40468.1	9.40e-187	13	776	120	888
QYH55287.1	3.43e-186	24	804	131	916
EAR14585.1	8.99e-185	6	708	126	849
QEC65642.1	9.90e-181	20	706	154	858
VTR42975.1	9.05e-179	19	727	158	882

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.22e-147	28	718	314	1009	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.08e-140	22	727	136	870	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	7.35e-92	19	706	178	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	4.89e-147	28	718	314	1009	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.05e-137	20	710	177	883	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.93e-129	20	711	173	884	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	3.67e-59	27	705	194	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003258_01333.