CAZyme Information: MGYG000003261_00144

Basic Information

• Species: Collinsella sp900761995
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900761995
• CAZyme ID: MGYG000003261_00144
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720		78892.38	4.8529

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003261	2233075	MAG	Peru	South America

• Gene Location: Start: 2033; End: 4195 Strand: +

Full Sequence      

MNESIYELRVSRAASGAYPTISDALAATDQLYPDAEQAVTIHIDPGEYRERVEIHRPHVT
LAGETADSVRIVGSLGAKMPSEDGSGVDGTLGTFRTYTVLVDADDVRLENLTIVNDAGDG
REVGQAIALYADGDRLVVDACCITGRQDTLFLGPLPPREVKPGGFMGPKQFAPRRVGRQY
FRRCRIEGDVDFIFGGARAYFEGCEIRSLNRDMDVNGYVTAASTPEGEPYGFVFHGCSFT
ASQDVASDSVYLGRPWREWAQTVLIDCWLGQHIKREGWWDWNKPAAHERARYAGTSLHGP
AGDAAGWAPWARELDATAAARYAREQVLAGADGWDPEGGDGDAVETASLSDSGRTVHIDI
YYEDEPALRDRLKREGRSAAFKGATPGDFEAWQIATRDRLFDLLGLSIMDRAPIEVRELD
RVQIAGGIVRTHAMLQVERDVWMPFYLLEPQTPKFDAHGCKRCYICPHGHQGAGGASVAG
VTGVPAVDDAVRKFNYDYGLRLARMGYVTVCPDSRGWGSRRDWKGQGDDENSYLRGTCLN
QARMAEPLGLTVAGLNAWDNMRLIDYLETRGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
RKAFVSGYLYGVDDSLLHLNGNCSCNYTPGLWRLLDMGDIASLIAPRPLLVQSCEKDHLN
GARGLANVDEQLAIVRDAYGLVGHADDLLHEVCPGGHHLGVAYLAEDIEWLDGHAARARS

Enzyme Prediction     

No EC number prediction in MGYG000003261_00144.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	329	8.8e-83	0.9826388888888888
CE19	463	697	2e-25	0.5783132530120482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	5.28e-67	6	330	81	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	8.35e-49	10	330	4	297	Pectinesterase.
PLN02773	PLN02773	9.19e-43	8	322	7	290	pectinesterase
PLN02708	PLN02708	1.51e-42	10	336	245	550	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	8.30e-41	8	332	13	290	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	0.0	1	716	1	716
ATP54718.1	0.0	3	716	5	716
QUC03567.1	0.0	8	719	7	713
QIX89293.1	5.19e-99	8	336	17	348
QRP39805.1	2.10e-98	8	336	18	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	8.89e-27	10	300	7	267	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	7.98e-25	14	278	15	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.46e-24	14	278	15	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
3UW0_A	1.96e-23	1	289	26	311	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	3.74e-22	6	289	4	287	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.35e-31	8	314	7	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	3.80e-31	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8L7Q7	1.21e-28	18	314	301	578	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9LXD9	2.00e-28	7	314	240	527	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
O04887	2.48e-28	10	310	205	472	Pectinesterase 2 OS=Citrus sinensis OX=2711 GN=PECS-2.1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003261_00144.