CAZyme Information: MGYG000003261_01311

Basic Information

• Species: Collinsella sp900761995
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900761995
• CAZyme ID: MGYG000003261_01311
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828		92587.75	4.9649

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003261	2233075	MAG	Peru	South America

• Gene Location: Start: 16098; End: 18584 Strand: +

Full Sequence      

MSIKRLALCRSQGRLFVLLRFAGKDVAGIIECEGSQAFAHATTNGASVPSLVLPVDHGRV
LAICPSVADYERELAVLVLPFLDGSAIDVDFASGGQKLGSIRLDSRKAKLESKINYKAKP
ALCALIRDAQRGERCGRYEIDAVRYLPADSSAVWRYEVTWAGDPQCTPQLRILDTHMNAI
DAMVHVFESQVDVPQQNGCRVNKTYLSVEMSEDIRDFVAIATDPAGQIQSGFCAMDGRLY
NGMVDDSWNRMKDARADDAAYRRWFEQHRAKPGDLACQRVAAAAFAYRPLVSIVVPCYKT
DRVYLRELLDSVLAQSYDNWELLLMDASPEWDAVANLAAAAHDERVRRIELPGNGGIVVN
TNAGIQQATGDYIAFLDHDDILELDALFRYVAALNKGAKDERPQVLFCDEDMFQKTGEWG
QPVFKTKLNVDLLYSHNCVTHFLMVEKALIDRIGVSPEDVAGAQDYDLTLRCLAAGARFE
HVAHVLYHWRVHPGSTADGSADSKPYAIEAGRLALQRHFDSLGVHGTVEESETPFVYRMR
YSLPEPAPLVSIVIPTKDHVETLDACVMSIAQKATYTNYEIVLVENNSEDPETFAYYETL
PERVAVASGGKGVARVEWWPGEFNYSQIINFGVKHAKGDYLLLLNNDTEVISPDFIEEMM
GYLMRPDAGVVGAKLYFADHLVQHAGIVVGVRGALAHANQDFSAKREGYLARAVRPGNFS
AVTGACQMVRRDVFEQVGGYNEEFAVGFNDADFCLRVWEAGYRTIFTPYAELFHYEFTSR
GREEADEEKLRRWKREQALFMQRWPEFFLDGDPWLGPNLSAESEYFSV

Enzyme Prediction     

No EC number prediction in MGYG000003261_01311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	292	451	4.6e-23	0.9764705882352941
GT2	551	737	1.2e-20	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.07e-83	289	491	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.78e-39	552	776	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.07e-31	548	801	3	248	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
COG1215	BcsA	6.97e-21	548	770	54	260	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06433	GT_2_WfgS_like	1.50e-20	292	496	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP53737.1	0.0	1	827	1	827
QIA33434.1	0.0	1	828	1	828
AZH69434.1	0.0	1	828	1	828
QOY61397.1	8.78e-297	1	828	1	801
ACV56016.1	7.92e-181	76	825	46	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.26e-09	290	389	6	107	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	3.57e-06	289	385	5	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	7.87e-113	258	826	338	895	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.73e-74	271	820	301	832	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q4UM29	1.62e-15	287	663	12	396	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q68X33	9.04e-15	287	498	6	218	Uncharacterized glycosyltransferase RT0329 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0329 PE=3 SV=1
Q9ZDI9	2.94e-14	287	498	6	218	Uncharacterized glycosyltransferase RP339 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP339 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003261_01311.