CAZyme Information: MGYG000003267_00765

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas
• CAZyme ID: MGYG000003267_00765
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		34940.74	5.4495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003267	1766327	MAG	El Salvador	South America

• Gene Location: Start: 4106; End: 5113 Strand: +

Full Sequence      

MLVIGLAGTELQAVERDWLQHPAVAGVILFARNFASRDQVQQLCAAIREASPRPLLICVD
QEGGRVQRFREGYSALPPLQDVAAGYADDPQATLAAVGEHAWLMASEIRASGLDLSFAPV
ADVGHGNLAIGNRAFHADPQIAAQCLAAYVAGMHQAGMPATLKHFPGHGTVREDTHVDIA
RDDRPLSALQAHDLVPFAAGIAAGADAVMMAHVVYPQVDDAPAGCSSVWINDILRGQLGF
RGVVVSDDIGMAASFQAGGVSGRVHAHLDAGCDIVLACHPELVPEALAAVEGRQLNTAAV
AALLGRGALGWGGLLADSRHPSAQSLLLETLGRTV

Enzyme Prediction     

No EC number prediction in MGYG000003267_00765.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	53	276	2.3e-52	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05337	PRK05337	8.79e-165	1	335	3	337	beta-hexosaminidase; Provisional
COG1472	BglX	2.75e-85	4	308	10	313	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.61e-75	1	306	9	312	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	1.11e-07	94	247	132	287	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGM06492.1	1.99e-176	1	335	1	335
QGL93947.1	1.99e-176	1	335	1	335
BCX44924.1	2.82e-176	1	335	1	335
QNG92348.1	4.00e-176	1	335	1	335
QGL85540.1	4.00e-176	1	335	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5G1M_A	2.60e-83	2	291	25	309	Crystalstructure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G1M_B Crystal structure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G2M_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G2M_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G3R_A Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G3R_B Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G5K_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5G5K_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
5G5U_A	8.31e-82	2	291	25	309	Crystalstructure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G5U_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_A Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_B Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5LY7_A Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5LY7_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
4GVF_A	2.19e-75	2	279	4	280	Crystalstructure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVF_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
2OXN_A	3.36e-75	2	279	4	274	Vibriocholerae family 3 glycoside hydrolase (NagZ) in complex with PUGNAc [Vibrio cholerae]
1Y65_A	3.56e-75	2	279	6	276	Crystalstructure of beta-hexosaminidase from Vibrio cholerae in complex with N-acetyl-D-glucosamine to a resolution of 1.85 [Vibrio cholerae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4SRK3	3.25e-176	1	335	1	335	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
B2FPW9	5.37e-175	1	335	1	335	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
Q8PMU1	6.28e-162	1	318	1	318	Beta-hexosaminidase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=nagZ PE=3 SV=1
Q2P4L0	1.80e-161	1	318	1	318	Beta-hexosaminidase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) OX=342109 GN=nagZ PE=3 SV=1
Q5H1Q0	1.03e-160	1	318	1	318	Beta-hexosaminidase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) OX=291331 GN=nagZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003267_00765.