CAZyme Information: MGYG000003267_01475

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas
• CAZyme ID: MGYG000003267_01475
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000003267_341|CGC1	39166.14	10.2521

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003267	1766327	MAG	El Salvador	South America

• Gene Location: Start: 1026; End: 2168 Strand: -

Full Sequence      

MSAPVVPATARPVVIMAGGTGGHIFPGLAVARELRARGIPVRWLGAEGAMETRLVPPHDI
AIDTLPISGVRGKGKLALLAAPFRIMRAVRAAGYALRNQQPRAVVAFGGFASGPGGLAGR
LLGVPLIVHEQNRAPGMTNRILSRFCRRLLVGFPGSFPSGEELVGNPVRSEIAAVAEPAQ
RLAARSGPLRVLVLGGSQGARALNNAVPQALATLGAAVTVEVRHQSGEKLLAEAQAAYAA
AGVQAEVTAFIADMAQAFAWADVVISRAGASTLAELCAVGVPSILVPFAAAVDDHQSRNA
EYLVEHGAAVLLKQDAGLADTLQHALQQLHDDPSRRLAMAQAARGLARVDAAARIADIIL
EESTMSTGKGGSATGNEVQA

Enzyme Prediction     

No EC number prediction in MGYG000003267_01475.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	191	351	6.1e-52	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	3.24e-155	11	361	2	353	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.65e-134	13	358	2	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	3.08e-126	11	359	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	1.57e-117	11	363	1	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	2.76e-42	191	355	2	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEE53045.1	3.02e-182	9	363	7	361
QGL91480.1	3.02e-182	9	363	7	361
QGL83281.1	6.08e-182	11	363	9	361
VEF37231.1	6.08e-182	11	363	9	361
QCB33335.1	6.08e-182	11	363	9	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	4.49e-91	11	357	7	348	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	5.99e-86	13	361	5	353	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	1.19e-76	11	359	10	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0RVA5	7.54e-171	8	379	17	384	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=murG PE=3 SV=1
Q8PCK0	1.07e-170	8	379	17	384	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=murG PE=3 SV=1
Q4UQX0	1.07e-170	8	379	17	384	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=murG PE=3 SV=1
Q8PPA8	6.86e-169	8	376	16	378	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=murG PE=3 SV=1
Q3BXF2	6.65e-168	8	369	17	376	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003267_01475.