CAZyme Information: MGYG000003268_00727

Basic Information

• Species: Prevotella sp900762125
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900762125
• CAZyme ID: MGYG000003268_00727
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580		63424.42	7.1032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003268	2466924	MAG	El Salvador	South America

• Gene Location: Start: 3366; End: 5108 Strand: -

Full Sequence      

MKAKRIILLPLLALAMTASAQAPAFPGAEGHGRYVTGGRGGKVIHVTNLNDSCEGSLRAA
VTQSGKKIVVFDVGGVIALKSDVKISANTTIEGQTAPYPGITLRYYTTHLNGDNIIVRFI
RFRRGQEKNVNDGADTFWGRQHTGIIIDHCSMSWSIDEVASFYDNNNFTLQWCMLGEALA
NAGHGKGAHSFGGIWGGKLASFHHNYLGFMHNRTPRFNGARYNWTGYSSNKLYSTYNWKN
AVQAENVDFRNCVMYNWGTGNGCYGGPGGGYVNIVNNYYKAGPGTKNKKRVTEISVAEDG
NSGDNSPYIKMTSRYYIKGNYVTAADAKAANYDWSGVKIDDGTYTIDGEEYTYDNKHYYG
SKVTYKKNTNGEDCVKIKLDEPTATGEVTTHSAEQAYDKVLAYGGASLYRDDVDARYVKD
TKAGTTTYTGSNGTKTAGIIDLVKDCNGYTEETPGWQETKTTLVDSDGDGMPDDWETANG
LNPNDDSDASTYTLDKKGYYTNIEVYCNAIVEDIMKLENAGAESSVDEYYPTVTKPTAGI
KSPFVHAAANNGLAYNLAGQRVSDSYKGIVIVNGRKMIRK

Enzyme Prediction     

No EC number prediction in MGYG000003268_00727.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	74	279	3.8e-67	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	4.55e-08	16	312	22	324	Pectate lyase [Carbohydrate transport and metabolism].
pfam18884	TSP3_bac	0.005	465	485	1	21	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
smart00656	Amb_all	0.010	85	153	14	79	Amb_all domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28243.1	3.29e-235	1	535	1	529
VEH16322.1	5.22e-232	20	535	25	534
QNT67774.1	1.26e-230	20	580	2	575
QCD40778.1	2.75e-225	19	559	16	569
QCP73827.1	2.75e-225	19	559	16	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	1.23e-06	29	172	46	187	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	7.88e-48	24	511	22	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	5.41e-46	24	511	22	414	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q0CLG7	1.98e-45	24	511	22	414	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
A1DPF0	2.58e-43	24	511	23	415	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q4WL88	9.37e-43	1	511	1	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999086	0.000164	0.000179	0.000162	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003268_00727.