CAZyme Information: MGYG000003268_01454

Basic Information

• Species: Prevotella sp900762125
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900762125
• CAZyme ID: MGYG000003268_01454
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662	MGYG000003268_204|CGC1	73790.2	7.3078

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003268	2466924	MAG	El Salvador	South America

• Gene Location: Start: 10227; End: 12215 Strand: -

Full Sequence      

MKHLALFLTLSFFALQARAQDPWRLRAETIDTANYYGATVANGMLGITSSPTPLHCATTI
LYGAYDGDTQSAIPRLFDNIHFLDLDLVIDGQPCDRQHITGHRQELDMRHAQFREHFVIN
GKATVDSRTMALRQMPFAALTIVTVMPQRDLVLTVANRHRVPAGILGATGRYRMMKKKRA
NLYLLATDARSALGRHGITATSSFLFPTKDYPTVTTDSASMMTFSVRLRKGEAYTFGLTG
AVQTTATHPDAANEADRLAIFASLTGLATLERDHLLAWDRLWQSDITITGDAQAQQDVHG
MLYQLYSAIRDGSRLSIPPAGLTALTYNGHIFWDAEIWMYPALLVLHPELARQMISYRID
RLRAAQRNAFAHGYNGAMMPWESADSGLEDTPSWATTGTNEHHITGCVAMAAWQYFCVTR
DTLWLRDEAWPLLRETADFWISRMQQDSTGQWHIRNVVCADEYAANVDDNAFTNAIAMEN
LRITTKAARLLGMPVKAAWQQRQQALPILTMANGVTAEYEGYDGQTIKQADVTLLSYPLK
TITEPQQMLRNLEYYHEKIGGKEAPAMTEAISALLYSRLGKGREAGRDFRKGYMTHLCPP
FRSMAECQGGTNPYFLTGAGGLLQTVIMGFAGYDITDDGLRQLHGTALPEGWKAVKVKII
GF

Enzyme Prediction     

No EC number prediction in MGYG000003268_01454.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	302	637	1.5e-94	0.9865591397849462

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	7.38e-96	21	660	9	723	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	4.02e-60	302	640	4	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	6.40e-27	214	484	233	507	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	0.004	39	236	18	231	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMI82226.1	3.32e-224	20	661	19	666
AMR29748.1	3.90e-221	19	661	22	669
QNE40735.1	2.28e-220	21	661	35	680
QEM10436.1	6.76e-220	16	661	22	672
ALW84313.1	6.91e-219	17	661	29	678

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	4.24e-195	20	661	21	668	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	1.72e-42	273	659	281	718	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	5.42e-28	276	660	275	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	1.27e-27	276	660	275	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	3.56e-67	270	662	254	652	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
Q32M88	3.70e-60	274	640	231	609	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Homo sapiens OX=9606 GN=PGGHG PE=1 SV=2
F1NZI4	1.03e-58	269	641	236	620	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
Q8BP56	1.63e-58	253	640	206	608	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Mus musculus OX=10090 GN=Pgghg PE=1 SV=1
A0JMP0	5.64e-52	263	658	175	583	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Danio rerio OX=7955 GN=pgghg PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000221	0.999154	0.000172	0.000151	0.000145	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003268_01454.