CAZyme Information: MGYG000003268_01803

Basic Information

• Species: Prevotella sp900762125
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900762125
• CAZyme ID: MGYG000003268_01803
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		40852.84	8.5811

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003268	2466924	MAG	El Salvador	South America

• Gene Location: Start: 8082; End: 9191 Strand: -

Full Sequence      

MNLKKATFSTLLCLLALSAGSINAVAQKLTPATNPAITFTGRTVANAADGSVTFDWIGTH
LSTIFNGSSVAMKVSDTGTSYYNIFIDNQPARKIKVTGKAPQVVQLATKLAKGSHRLTVQ
KCTEGEYGCGTIYGLLTADGRLTAPTPKKRLIEVYGDSYTCGYGTEAKSKSEHFTLETEN
CNKAYTCIISRYFDADYVMIAHSGQGIVRNYGDKVQQSKPKNMGTRSLQIFDEHDTLGYD
FKGYRPDMVIICLGTNDMSPICPPTTDMFCKGYIQLIQRIKAAYGDVPVFCVTPHSANNY
LQENMRELQRRTVGMGRIIFTPLMTRIVREDTDLGADWHPNYEGQRKIAMTLIPQISYVM
GWPMKGEQE

Enzyme Prediction     

No EC number prediction in MGYG000003268_01803.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	152	356	5.6e-51	0.9904306220095693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	2.38e-35	152	356	2	168	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam17996	CE2_N	2.32e-23	39	147	1	108	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
pfam13472	Lipase_GDSL_2	2.34e-12	154	347	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	2.69e-12	152	355	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01834	SGNH_hydrolase_like_2	1.20e-06	222	355	38	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85000.1	4.49e-124	34	367	30	362
QUB47786.1	2.09e-120	32	369	62	399
QUT38028.1	1.37e-94	37	367	35	363
ALJ42468.1	1.56e-93	37	367	35	363
QMW87494.1	1.56e-93	37	367	35	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	1.77e-37	34	362	8	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	4.80e-37	34	362	8	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2W9X_A	3.32e-27	51	361	47	358	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]
2WAA_A	2.20e-25	32	362	15	339	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]
4XVH_A	3.74e-23	56	362	17	329	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	8.58e-35	34	362	489	814	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PDE5	1.66e-26	51	361	47	358	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1
B3PIB0	1.41e-24	32	362	34	358	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999150	0.000151	0.000169	0.000138	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003268_01803.