CAZyme Information: MGYG000003270_00949

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae
• CAZyme ID: MGYG000003270_00949
• CAZy Family: GT51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		44064.7	4.784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003270	2383092	MAG	El Salvador	South America

• Gene Location: Start: 14; End: 1219 Strand: +

Full Sequence      

MRLFDYDGVREDSISSMDSIRYMVRFMHTAFVAMEPQSGHVKAWVGDIDFRTWKYDKVTA
KRQPGSTFKLFVYTAAMNSGLAPCDRRVDSWMSLDVTGPDGKPTKWSPRNANGVYSGDSL
TLKSAFAQSINTVAVKLGLEVGIPNVIATAHDMGIKSKLDNAPALSLGASDVSLLEMVNA
YSCVANDGVHHDPVLVTRIEDSKGNVIYTAPDAQRQAIPYRSAFLMQQMLMAGMREPGGT
SMALWGYVGQFCGDTDFGGKTGSSSNYSDAWFVGVSPALVVGAWVGGEYRCIHFRNSQFG
QGSRAALPLCGYFLQSVMADERFRRYHRKFGDPKEPIPASEYGCAACWKEPVDSDSLSFG
ADSIFLLDKGEEIILPEEELDNLDDEPILDDDDRPKTDPSI

Enzyme Prediction     

No EC number prediction in MGYG000003270_00949.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	9.60e-77	30	320	258	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	5.40e-71	24	286	323	570	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.01e-54	30	335	422	732	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	1.56e-37	29	286	406	656	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
TIGR02073	PBP_1c	1.12e-28	29	286	275	516	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO49868.1	9.45e-163	1	373	417	795
QUB46878.1	6.37e-160	1	368	418	789
EFC71818.1	4.62e-159	1	378	418	801
QVJ82183.1	1.07e-156	1	371	379	747
ADE81110.1	1.07e-156	1	371	379	747

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZG8_B	2.73e-24	32	286	181	431	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3UDF_A	5.56e-24	32	318	391	716	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
4OON_A	8.30e-23	29	321	396	726	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	1.44e-22	27	286	413	667	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	1.46e-22	27	286	434	688	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70997	2.20e-38	27	286	325	580	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
O87579	3.46e-33	30	286	424	677	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
Q92G78	2.09e-32	30	321	420	720	Penicillin-binding protein 1A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=mrcA PE=3 SV=1
Q4UK08	2.09e-32	30	321	420	720	Penicillin-binding protein 1A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=mrcA PE=3 SV=1
Q9ZCE9	6.93e-32	30	321	420	720	Penicillin-binding protein 1A OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003270_00949.