CAZyme Information: MGYG000003270_01301

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae
• CAZyme ID: MGYG000003270_01301
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212		22844.8	8.6124

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003270	2383092	MAG	El Salvador	South America

• Gene Location: Start: 1194; End: 1832 Strand: -

Full Sequence      

MIASIGLATKPATDAKCRELPIVAVVPGSRRKEIADNLPVMIRAYEAVGGVQPVIAAAPS
IDASLYRRVLQESDCRTDYRLVAGRTMELVSHARVALVTSGTATLETAVIGTPQVVCYRM
GGSKILYDFYKMLLKVRFVSLPNLIVDAPVVKELLMHHCSVDNVAAELRALLPDSDARRT
MLQGYAEMNVRLGDNDCAAVAAGGIVAHLKKL

Enzyme Prediction     

No EC number prediction in MGYG000003270_01301.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	19	190	4.4e-44	0.4745762711864407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	9.35e-38	8	192	168	359	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.38e-37	21	196	189	366	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.10e-24	9	180	167	347	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	9.70e-12	17	163	164	308	lipid-A-disaccharide synthase.
PRK01021	lpxB	1.72e-09	21	171	414	569	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64292.1	9.50e-48	14	212	183	377
QQR08529.1	5.58e-46	21	203	191	368
ASB37800.1	5.58e-46	21	203	191	368
ANU64105.1	5.58e-46	21	203	191	368
BAX81022.1	9.19e-43	13	211	181	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	7.63e-12	14	195	190	368	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	7.63e-12	14	195	190	368	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.50e-23	18	209	187	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	1.91e-21	19	211	187	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q2IL69	3.64e-21	23	194	195	367	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	5.02e-21	23	194	195	367	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	6.92e-21	23	194	195	367	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000021	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003270_01301.