CAZyme Information: MGYG000003271_00060

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera
• CAZyme ID: MGYG000003271_00060
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
538	MGYG000003271_30|CGC1	61145.11	9.3721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003271	1418700	MAG	El Salvador	South America

• Gene Location: Start: 2162; End: 3778 Strand: +

Full Sequence      

MRHRTVLFLVAVVCFLFLLAGNSLLPVTDPVESNYALTAKEMVLSGDWISPQIYGTYWYD
KPIFLYWLLCLSYAVFGFTDFAARLPSALFGTLSVIIAVWYMLRRYQRVWPALLLAAMTI
TSLEVWAVSHSIITDQMLFAFTAATMFFAYIGLTEGKKNFVIAAYASAALSVLTKGPVGI
VLPGLFLLIFIALRRNTTYLKRLFPPAGILLFCIISLSWYGTMYVRHGMDFINGFLGLNN
VVRATVSEHPQYNVWYYYVILVPLSLLPWTGPCLYGLWKRRGWNDEYVYMAVWAVGTILF
YTCMATKYPTYAYITNMPLLFLGAQTILMLYQQEKRRLWTILTGPALCYWLLFFVAALVA
KPKTFEMGSLWSLLMLFVIAAACLIFAQWQKAFTALPATIAIATAAIYIILTYQVLSPFY
AYRSSVHVLPAVPQLKDTVYFYEQYSTSFPYYTGKTAVFVSQSGSMTKGDNKGRAAAWQG
KYLYPRETLDALALRLQQHESVSIIVPQSEYDTFVQTSCYPLTTFVGKFNAFYVFSSR

Enzyme Prediction     

No EC number prediction in MGYG000003271_00060.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	480	9.4e-90	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.28e-40	7	382	10	392	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	4.19e-25	5	389	8	395	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	3.21e-15	60	195	1	135	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.08e-08	32	226	32	237	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	3.96e-04	55	175	56	177	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL21032.1	2.15e-249	1	537	1	536
AXB83023.1	8.59e-204	1	538	1	537
CCC72525.1	8.94e-200	1	535	1	532
AVO73980.1	8.94e-200	1	535	1	532
ALG41393.1	1.27e-199	1	535	1	532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	5.50e-25	30	311	57	348	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SQX1	8.29e-29	26	337	24	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	2.74e-28	26	337	24	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
B2VBI7	6.21e-25	29	324	29	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
O67601	2.16e-24	7	322	5	325	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A4TIM6	6.46e-24	17	324	20	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis (strain Pestoides F) OX=386656 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.886511	0.111045	0.001546	0.000210	0.000172	0.000519

TMHMM  Annotations     

start	end
5	27
62	79
81	103
108	130
137	154
169	191
203	225
254	276
288	305
309	331
338	360
370	387
394	416