CAZyme Information: MGYG000003273_01255

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; RUG11200
• CAZyme ID: MGYG000003273_01255
• CAZy Family: GH133
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		40038.22	4.578

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003273	1524353	MAG	El Salvador	South America

• Gene Location: Start: 469; End: 1518 Strand: -

Full Sequence      

MIAITGLTLCTGRYKDNEEILESFSKYLKNGLIPNMFPSADSEQPIYNTVDASLWYFYAV
DKYLEYTGKKENYDFIEKKIYPCLKEIINAYESGTDFSIKMDSDGLIMAGSDLDQITWMD
VRVGDWVVTPRHGKPVEISALWYNALKVMEKLSRKFGEDSSKFTSLSEMVKKSFNEKFWN
EDKNCLYDVVDENDDKVRPNQIWAVSLPYTMLDRDKEKKIVDTVYEELYTSYGLRTLSYR
DKEYVKEYIGPLSKRDAAYHMGTTWPFPEGGFISAFCKVNDYSDECIKRAKQMVEAFTDH
MDDGCIGGIAEVFDGTNPCTGNGCYSQAWSVGEVLRAYVEDVVGKGNRQ

Enzyme Prediction     

No EC number prediction in MGYG000003273_01255.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH133	1	336	3.8e-109	0.9220430107526881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06202	GDE_C	3.98e-152	1	336	36	374	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
TIGR01561	gde_arch	7.34e-83	1	276	299	574	glycogen debranching enzyme, archaeal type, putative. The seed for this model is composed of two uncharacterized archaeal proteins from Methanosarcina acetivorans and Sulfolobus solfataricus. Trusted cutoff is set so that essentially only archaeal members hit the model. The notable exceptions to archaeal membership are the Gram positive Clostridium perfringens which scores much better than some other archaea and the Cyanobacterium Nostoc sp. which scores just above the trusted cutoff. Noise cutoff is set to exclude the characterized eukaryotic glycogen debranching enzyme in S. cerevisiae. These cutoffs leave the prokaryotes Porphyromonas gingivalis and Deinococcus radiodurans below trusted but above noise. Multiple alignments including these last two species exhibit sequence divergence which may suggest a subtly different function for these prokaryotic proteins. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG3408	GDB1	2.27e-81	1	344	290	609	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
TIGR01531	glyc_debranch	5.23e-23	2	340	1044	1463	glycogen debranching enzymye. glycogen debranching enzyme possesses two different catalytic activities; oligo-1,4-->1,4-glucantransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). Site directed mutagenesis studies in S. cerevisiae indicate that the transferase and glucosidase activities are independent and located in different regions of the polypeptide chain. Proteins in this model belong to the larger alpha-amylase family. The model covers eukaryotic proteins with a seed composed of human, nematode and yeast sequences. Yeast seed sequence is well characterized. The model is quite rigorous; either query sequence yields large bit score or it fails to hit the model altogether. There doesn't appear to be any middle ground. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam17389	Bac_rhamnosid6H	7.58e-06	24	183	65	218	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAA34021.1	2.31e-187	1	343	325	669
QNO15085.1	4.58e-167	1	343	323	664
CDM68469.1	8.82e-163	1	342	326	666
BCZ47409.1	2.62e-159	1	343	327	668
AWB43120.1	8.15e-159	1	343	326	667

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8BQB4	6.75e-11	2	335	1106	1527	Glycogen debranching enzyme OS=Equus caballus OX=9796 GN=AGL PE=2 SV=1
Q2PQH8	1.20e-10	2	335	1106	1527	Glycogen debranching enzyme OS=Canis lupus familiaris OX=9615 GN=AGL PE=2 SV=1
P35573	8.88e-10	2	335	1105	1526	Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL PE=1 SV=3
P35574	1.18e-09	2	335	1128	1549	Glycogen debranching enzyme OS=Oryctolagus cuniculus OX=9986 GN=AGL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999992	0.000063	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003273_01255.