CAZyme Information: MGYG000003277_00295

Basic Information

• Species: Duncaniella sp900762315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900762315
• CAZyme ID: MGYG000003277_00295
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000003277_12|CGC1	43418.45	9.6884

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003277	3767547	MAG	United States	North America

• Gene Location: Start: 15882; End: 17066 Strand: -

Full Sequence      

MKLFISAGEASGDLHASQVIRELRRIDPGVEITFLGGDLMARETGHEPLIHYRDMAFMGF
TEVIKHLPQIYRNLGTAKGAISRERPDALLLVDYPGFNMEIAAYGRALGIPVYYYIAPKV
WAWKSYRVKALKRDVKRIFSILPFEPAWFDRHRLQVEYVGNPSVEEVNAAIAALPEKSQF
LSHHNLPADKPLLAIVPGSRRGEIKCNLPVMDAVAKRHPELCAVIAGAPGIDLSVYRRYS
SLPVINASTLELMAHSRAALVTSGTASLECALAGTPQVVCYRSIGWKPAHDLFTHILKIP
YVSLPNLIAGPISEKARKEQNRKGVVRGHIIPEMLVHHCNPDEVDAQLTPLLGNTEERAR
QIGGYARMRGLLSSSMSAAATVAARLNSLVKTGK

Enzyme Prediction     

No EC number prediction in MGYG000003277_00295.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	370	2.1e-101	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.03e-104	1	388	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.52e-91	1	369	2	359	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.96e-71	3	361	1	348	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.97e-53	5	369	10	366	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.60e-41	1	308	2	286	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP71596.1	7.44e-168	1	386	1	388
QCD40491.1	7.44e-168	1	386	1	388
QCD36425.1	9.17e-135	1	381	1	366
QQR08529.1	1.35e-130	1	389	1	373
ASB37800.1	1.35e-130	1	389	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	9.62e-38	1	354	7	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	9.62e-38	1	354	7	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4UHR6	3.24e-61	2	372	10	365	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
B8JE78	3.24e-61	2	372	10	365	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
Q2IL69	4.56e-61	2	372	10	365	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q02AZ6	5.09e-59	2	391	3	374	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q1D393	4.12e-58	2	378	6	367	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003277_00295.