CAZyme Information: MGYG000003277_00827

Basic Information

• Species: Duncaniella sp900762315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900762315
• CAZyme ID: MGYG000003277_00827
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
960	MGYG000003277_40|CGC1	106163.84	5.221

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003277	3767547	MAG	United States	North America

• Gene Location: Start: 6565; End: 9447 Strand: -

Full Sequence      

MRYSYLLTGALLSVMPLSAQEMTDIGSTPWRFSKIVRTDANLAPKSLVSVGPRSVAELTD
GDKTRDWAPDAAVPLTIDLHDPCRLASVTLHYAGDAVTSASVEIEGSLDGVTWTRLSDGG
VSRPCVANKTNDLAAVGETFGYVERITDTSLTVSVDGEYRLLRVKSPRPFSEIVVNPVAG
DDGFSPSQLSAAAFDDSGWEQVGIPHCYNERDTYLNSTKGELCWRGEAWYRKKIKISRSD
RGKQLFLRFNGVNIGMTLYVNGHPVNMTTSAVQQPSDVTHVGSSIPFAVNITPYVEWGKE
NQIAVRVSNSRDTFFTYPEFAENEGFGQAMGGIVSPVWLCAKSDVYIPFNTYAPHGKWGT
YFGTVSATPSQAVLRFVTRVENTSAKDRDVRLVTALKDKEGKTVFSRAATRRVAAGETGQ
FDFSGPLDNPVLWYPVGSPSGGPYLYTVENSVYVDGKLKDRVVEKMGIRTVTWDKNYCYI
NGEKTILRGFGYRNSYPGLGAAVPVAMRWDDVKRIADCGGNTFRVGHQPPFYEAVEACDE
YGVMLILNSGDNEWALKNEPACTYKQEYDRDAVIAFRNHPSVIVWESNNGLARDGERYLP
SRTLAEVKKHDFIAPRIVLNRDGYPPEWDEAENVVVGYTNWYWKDDRAPSINTEVYGTNW
NGDPSFCIARDDYDNEVKFSQYYVENYLDNLDNRACGWIDWMLAETYGEGYTIYLNGRRD
QKSLGSCAMDGSRIPKLKYRIYRDALWNSYDRHPGVALQSHWNYSGVVDVNAWSNCPRVE
LFLNGCSLGTVTPDSRTRRCVWKDVAWEPGTIEAVGLDADGNPVCRESAVTAGDPYAVEV
TVEPNSSTPSGTAFPLRANGSDAVVVTARVVDKDGNWCPRADNLLRFDVSGEGVYKGGYN
FYITDGQDMGYHAPGDPELQAEGGLIRAAVRTTFTPGPITVTVTSPGLKPGMATVKSVKK

Enzyme Prediction     

No EC number prediction in MGYG000003277_00827.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	190	603	1.4e-64	0.4348404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.05e-28	229	645	66	484	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.42e-28	226	585	65	412	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	4.42e-23	856	954	10	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10340	ebgA	1.97e-19	230	589	113	448	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam16355	DUF4982	2.21e-15	767	827	3	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74086.1	0.0	20	959	24	972
BCF94458.1	6.72e-144	194	954	47	831
AXF04603.1	7.91e-144	194	954	67	851
AUT65738.1	2.12e-143	194	954	67	851
AUT74975.1	3.91e-143	194	954	67	851

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	1.19e-76	185	957	50	804	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
5T98_A	2.44e-54	191	955	46	818	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4CU6_A	1.37e-53	195	960	39	847	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
4CUC_A	1.37e-53	195	960	39	847	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]
7CWD_A	2.02e-51	193	955	27	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	5.85e-76	185	957	41	795	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	2.34e-57	188	949	60	840	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KPJ7	1.02e-35	193	878	73	757	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KM09	2.73e-31	189	892	65	759	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P12265	5.61e-13	226	747	97	623	Beta-glucuronidase OS=Mus musculus OX=10090 GN=Gusb PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000492	0.998649	0.000274	0.000212	0.000172	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003277_00827.