CAZyme Information: MGYG000003277_01481

Basic Information

• Species: Duncaniella sp900762315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900762315
• CAZyme ID: MGYG000003277_01481
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461	MGYG000003277_74|CGC1	51881.84	5.5801

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003277	3767547	MAG	United States	North America

• Gene Location: Start: 32739; End: 34124 Strand: -

Full Sequence      

MRKLAIAAVLMAGMAGCGGHSDRVPDTDADTLHHLPDTLRVATLYSPESYFIYRETRMGY
DYELVSRLAADRSMTLDLQVAPSLSAAVEMLDSGLVDLIAYEVPVIAEYREHVVPCGPEN
ITTQVLVQPRTGRDGEERIDDVTRLVGRDVYVERDSKYEARLRNLNDEIGGGINIHTVDR
DTLIAEDLIAMVSNGEIPLTIVDSDIARINKTYYNDLDITMQVSFPQRSRWAVGLDKKWL
ADSIDSWLTGDRPRSQQAELLKRYFEMSKTESSRLPVIDLSRGRISPFDGLFRKYAGEIG
WDWRLVAAQGYAESRFDSTLVSWAGAKGVMQIMPSTARAYKAEAQMTSNAVSIATACRII
RDLDKSLAARVPDPEERKKFVVAAYNSGLAHVLDAIALAEKYGLDPRRWDGNVDRAILMK
SKPEYYNDPVCRYGYFRGRQTTEYVAQVFDFYNRARSSIKP

Enzyme Prediction     

No EC number prediction in MGYG000003277_01481.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	301	456	4.3e-20	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10859	PRK10859	8.98e-67	1	453	6	448	membrane-bound lytic murein transglycosylase MltF.
cd13403	MLTF-like	2.11e-65	292	453	1	157	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd01009	PBP2_YfhD_N	7.75e-56	38	266	2	223	The solute binding domain of YfhD proteins, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes the solute binding domain YfhD_N. These domains are found in the YfhD proteins that are predicted to function as lytic transglycosylases that cleave the glycosidic bond between N-acetylmuramic acid and N-acetylglucosamin in peptidoglycan, while the YfhD_N domain might act as an auxiliary or regulatory subunit. In addition to periplasmic solute binding domain, they have an SLT domain, typically found in soluble lytic transglycosylases, and a C-terminal low complexity domain. The YfhD proteins might have been recruited to create localized cell wall openings required for transport of large substrates such as DNA. They belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.
COG4623	MltF	4.09e-52	39	453	25	429	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	1.74e-13	292	399	1	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD39868.1	1.08e-201	4	456	15	459
QCP73516.1	1.08e-201	4	456	15	459
QCD43102.1	8.80e-201	4	457	12	460
ASB37997.1	5.85e-199	4	460	15	461
QQR08735.1	5.85e-199	4	460	15	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OYV_A	2.69e-30	39	453	20	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OZ9_A	1.17e-29	39	453	13	419	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.28e-29	39	453	20	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	7.36e-29	39	453	6	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	7.36e-29	39	453	6	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	1.14e-40	41	453	45	446	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q4KHS7	1.21e-37	39	453	43	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mltF PE=3 SV=2
Q3KHL5	2.29e-37	3	453	13	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=mltF PE=3 SV=1
B0KRE9	6.38e-34	39	453	43	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain GB-1) OX=76869 GN=mltF PE=3 SV=1
B1JDH3	8.74e-34	39	453	43	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain W619) OX=390235 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000051	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003277_01481.