CAZyme Information: MGYG000003277_02976

Basic Information

• Species: Duncaniella sp900762315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900762315
• CAZyme ID: MGYG000003277_02976
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700	MGYG000003277_151|CGC1	77951.15	4.6603

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003277	3767547	MAG	United States	North America

• Gene Location: Start: 4378; End: 6480 Strand: +

Full Sequence      

MNLRYCAISIALTCLSPVAARDFVHPGVTYSQSDLDRMRAMVETRQEPYYSTFLKLKDSG
YSRLVVRDRGTSIPEGKFNQTVGDDGRRAHDMALLWHITGDNAYADNVVKILNWSSRYTN
TSSRGTAALDNGKIYLLIEAAELMRDYPGWAEEDKQRFKDMLVYPGYSDTEVPTSHYSLN
DDENDVTFYWNIYNFDASRFGNQGLFAARAMMAMGVFLDNEKIYDRAYRYLTGQPHRSDD
LPYVAGPPVTSTTPYPLNSDDPTAGDNTTSFMLGYKLNGRENTVEDYGYDEQLRYYIYAN
GQSQEACRDQDHAMVGTGLFVDIAEIAWNQGDNLYGELDNRILAGLEWAFRYNLSYIENP
ADAWEPAGYTRDENEAAENPELFYQVRSRSGRWESVAPSTKGRGDSFMGGGNRECALAHY
AVRAGLDQQQWEWTGKYRDYMIENFGCESYGKDANHAYEWAGWGTLTKRRENDMAGDPGR
WEDGTFIPRLNTTDEEINCADYDRHGDCAGGHTCSGNYESAYRSDGRGMDITVSNGQPVI
SGLNPGDWMNYTVFIPADGEYDITITHCGNETSECSIGYGRQTVTLPASQNFVTTKIGTF
SLPAGVSVIKLATPRPATGLQLASMRVTPAQTTVLSTLMNESPSITVSGSTVTTSSHGGI
TAYDSLGRTVASTTGRTLLLEPGLYILHSANSRPVKTIIR

Enzyme Prediction     

No EC number prediction in MGYG000003277_02976.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04080	CBM6_cellulase-like	4.66e-12	497	611	5	129	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
pfam05426	Alginate_lyase	5.27e-05	83	227	55	193	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
cd04086	CBM35_mannanase-like	2.81e-04	544	611	33	104	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
cd04079	CBM6_agarase-like	0.002	520	611	16	115	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT82474.1	2.98e-221	21	611	26	620
QDM08619.1	2.98e-221	21	611	26	620
QRQ56347.1	3.56e-221	21	611	26	620
SCV08998.1	3.56e-221	21	611	26	620
ALJ49575.1	3.56e-221	21	611	26	620

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001311	0.802893	0.194918	0.000316	0.000273	0.000256

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003277_02976.