CAZyme Information: MGYG000003279_00303

Basic Information

• Species: Alistipes sp900541585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900541585
• CAZyme ID: MGYG000003279_00303
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284	MGYG000003279_2|CGC1	33183.32	9.8486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003279	3216844	MAG	United States	North America

• Gene Location: Start: 46892; End: 47746 Strand: -

Full Sequence      

MKHEARIPKIIHWCWLSGEPVPEFLRECMASWKRRMPDYVLKCWTQENFDIHAVKWVEEA
VEERKWAFAADYIRLYALHTNGGIYLDSDVEVFRPFDKLLGYEFFTGTEYSPIDYKYADV
PIDAQGIPLDRDAFVPGYGIQAAIMGAAKGSGFVRECMDYYEGRHFREADGRLRTDLTMP
LVIAKIAERHGFRYLDKEQVLGGGRLYIGRNSLLPSSIHLLRLGTAAFHHCAGSWLDPDC
RLKRQMIGGQRIRLALKYAFKAYRWRRRKKRAARKRLKQQNNRT

Enzyme Prediction     

No EC number prediction in MGYG000003279_00303.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	26	100	5.7e-21	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.54e-16	2	103	77	181	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam05704	Caps_synth	1.16e-13	2	106	41	151	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam04488	Gly_transf_sug	1.90e-11	22	105	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47110.1	7.14e-71	7	237	3	233
CBK68805.1	1.39e-69	7	235	2	231
QUR43722.1	1.39e-69	7	235	2	231
QRM97945.1	1.39e-69	7	235	2	231
BBA29457.1	2.32e-67	7	235	2	231

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003279_00303.