CAZyme Information: MGYG000003279_02016

Basic Information

• Species: Alistipes sp900541585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900541585
• CAZyme ID: MGYG000003279_02016
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403	MGYG000003279_17|CGC4	44873.04	5.1487

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003279	3216844	MAG	United States	North America

• Gene Location: Start: 420129; End: 421340 Strand: -

Full Sequence      

MKKRLIPAALCALAAACTSSGALYESGNPPAVRMAASEIVRNPSPTNLDGIPAGKVKWNY
TTGLELLAIADAGRMYGIEEFTAYAERYFDTIVRPGGEVLTYKKTKYNLDHVCPGRALFE
LYDRTGDVRYKMALDTLYAQLQEQPRNADGGFWHKKVYPHQMWLDGLYMAQPFYAEYAAR
NLSGAGYEKAVDDIVNQFVVVAAHTYDPATGLYRHAYDDSREMFWCDKTTGQSAHAWGRA
MGWYAMAIVETLQYLGVDDATQPMVEILNHIYEVLPKYADPATGMWYQVLDQPGREGNYL
ESTASAMFVYAMLKGVRLGYLPAELGGEARRLYEKFADCFVKENPDGTISLTGCCSVAGL
GGKQMRSGTFEYYISEPVIDNDCKGVGPFIWASLEIRLAQETL

Enzyme Prediction     

No EC number prediction in MGYG000003279_02016.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	55	396	1.1e-111	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.89e-91	31	395	2	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.93e-84	58	395	34	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63671.1	8.66e-294	1	396	1	396
CBK68198.1	4.76e-129	25	401	11	382
QGT73498.1	5.93e-129	19	401	22	399
SCV08369.1	8.40e-129	25	401	28	399
QQR18641.1	8.40e-129	25	401	28	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.26e-99	58	395	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.30e-59	57	397	38	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.24e-58	57	397	28	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	2.37e-17	141	398	178	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4XUV_A	8.69e-11	58	324	47	308	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.90e-58	57	397	38	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.11e-42	169	398	1	230	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.11e-42	169	398	1	230	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000050	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003279_02016.