CAZyme Information: MGYG000003282_00015

Basic Information

• Species: Coprobacter sp900545915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter sp900545915
• CAZyme ID: MGYG000003282_00015
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
912		103059.74	6.5328

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003282	3080391	MAG	United States	North America

• Gene Location: Start: 18230; End: 20968 Strand: -

Full Sequence      

MKIFSAILISGVFLTTACTQKENTVIYKGNTYTVYDNRVEQGKFRAVAISKDEIRSDYES
PADKGYSPTIHFKFSINSRDNELPAGEEHIITLKPQNDTCVSPVILFGERYTAIDTNAES
IPLPHRTVWTVRVDMSPMFEAFKKQGFYKTPTGDIISESDFKGVYIAGGSEPMTWDFENL
YSREGMELSDPDKNGIYEISLTMNTKEPRKENYSVWSLSADIDAFPQYGSQQLLIDALYR
MSLNELLDNIRPDGTLRAGAAWDGVWTRDISYSIYLALAYIYPDAAQKSLVAKVNNNRII
QDTGTGGAWPVSSDRMIWSVAAWELYKYTGDKEWLQYAFEVIRNSAQDDQFTLKDPTTGL
FRGEQSYLDWREQSYPRWMQPTDIYQSLCLGTNAVHCRTYGILAEMAAELGKDASIFQQQ
ADSLKTAINRHLWIETKEYYGQYLYGGIYPILSPGIDNLGESLSILFDIASNEQARRMIA
RIPVAEYGATSIYPQIGEIKPYHNNAVWPFVQAFWNLASAKAENEASVTRGLGALYRAAA
LFTTNKELFVASTGDYSGTAVNSDKMLWSLSGNIAMIYRLFYGMKFETDGIRFTPFVPQS
IAGNKRISNFNYRKAVLQIDLSGTGNRIKKFTIDNEEQAEAFFPATLTGMHTIKIELEAD
FRTRDSITVRPITDMPETSRLGYQKDNNTLEILNYSPDNRYIVYLNGKGERIIMQRYYGL
PVLDRFTRVAAVPVNRSGVAGFTGKPFTWLPPHSEIRIEAESVIPKSPIKGSEYSGKGFI
EISKTKNRKIDLMIPINIPGRYAIDVRYANGNGPINTQNKCAIRSLFANGQFKGALVMPQ
RGENEWANWGYSNPVIVNLNRGGNKISIRFISPQDENMNGEINSALIDFIRLRRIGDINK
TPEARPIWLPKE

Enzyme Prediction     

No EC number prediction in MGYG000003282_00015.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.33e-10	306	441	79	222	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
cd04083	CBM35_Lmo2446-like	7.73e-09	774	870	23	110	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam06202	GDE_C	2.26e-05	255	514	20	306	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
cd04086	CBM35_mannanase-like	3.02e-04	756	868	1	104	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
COG3408	GDB1	3.44e-04	260	595	279	621	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63186.1	0.0	12	911	13	914
AHM62083.1	4.17e-288	1	895	3	900
ARS34527.1	1.54e-285	5	895	8	899
BAU55184.1	3.41e-281	1	895	23	907
QCD34626.1	5.92e-279	1	892	1	893

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000052	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003282_00015.