CAZyme Information: MGYG000003282_00536

Basic Information

• Species: Coprobacter sp900545915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter sp900545915
• CAZyme ID: MGYG000003282_00536
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925	MGYG000003282_6|CGC1	103148.06	4.4778

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003282	3080391	MAG	United States	North America

• Gene Location: Start: 22399; End: 25176 Strand: -

Full Sequence      

MKRLLMILIVCCGILGGISAQISGVYFPKMKSVQTPVFVSVGGATESPEALHICRIFQGI
INRDSAELFLSTGDKELDWFKYLDVKYKRPDKGVIVTGENRGLRTLFKSYKDRLDKLVVC
NFSDNDYTFNMALLMACAEDALPVSEELKDELIAEFGWDKEIVDIRNNWSTITQAYNWAL
EEIMPKLNKQLVFSIGLRDDWRSGGWRIYDYAVASRSFAFWVDDETTTGKNIIKKILNTS
GYPKNAVVMGYGMHGDDLNLTINPEGFGFVVSDLFPNASYYSSFPSETFEGHQPEGVAVD
AETNKVYVALHWSDGDNIQFNHNGTLDIWKQSERGKVPVSMTLSPALTEIAPFILQYYYE
NRTDNDEFIGGPSGVQYIQEPYYKPEDFESWCIMNGQYLKAAGMFSTASSLRWPAQPFYN
NGFVKTGVTGTLAWTNGAYKDAYNWCGMPIVGTGGVCSDEDGIYNYLKGVTARNDIPVFT
GVYMVQAGLGGAGYAAINRVVERLQSEFPEKYVFLKASDLLATAKKYFTERQKPYKDLFI
PGRIEAEDFDLGGQGAGFYDMETSNEGGAYRNEEGDYVGVGVGGSGYHVGWTTTGEWLNY
TVNVEKTSTYRMTVRYSTPSGQDKGICVMLDDEVLSSMELKSTSGVDDYTDYMVRVTIPE
GIHNLRVQITNGGMNLDYYDFEEDAEDIPAIEESKGYKIIAVHSGKVLALKTNNTTNGTK
IIQKEYTGDDTEIWKLNVAGDACYSLQNVASGLNIVLRGTNTIGQFPFDCTVNNGKWNLY
YQGDDCFTIVQKGALKYLEISDGSMDEGAELSLGEPTGEDNQKFRIEEVADYTGIDMSIA
SENSVGVVYPNPFVDEMYIPVSIKQPQNIEISLFDLAGRCVYRNTIFVTDGSRELVVSGN
KLPSGIYVWRLNGESVHSYGRVIKK

Enzyme Prediction     

No EC number prediction in MGYG000003282_00536.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM6	546	682	8.1e-26	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16216	GxGYxYP_N	2.13e-59	58	281	5	215	GxGYxY sequence motif in domain of unknown function N-terminal. This domain is found in bacteria, archaea and eukaryotes, and is typically between 213 and 231 amino acids in length. This domain is found in association with pfam14323.
cd04080	CBM6_cellulase-like	1.29e-35	540	682	1	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
pfam14323	GxGYxYP_C	1.32e-31	304	484	1	200	GxGYxYP putative glycoside hydrolase C-terminal domain. This family carries a characteristic sequence motif, GxGYxYP, and is a putative glycoside hydrolase. This domain is found in association with pfam16216. Associated families are sugar-processing domains.
pfam14200	RicinB_lectin_2	1.36e-11	697	762	15	80	Ricin-type beta-trefoil lectin domain-like.
smart00606	CBD_IV	2.04e-11	540	681	4	129	Cellulose Binding Domain Type IV.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77716.1	0.0	26	925	26	914
AXT61911.1	7.75e-28	529	763	236	452
ANH82740.1	2.99e-27	56	377	74	380
BCJ99038.1	1.95e-26	38	404	180	536
ACL15862.1	2.88e-24	529	685	1270	1425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5G56_A	3.87e-24	539	803	334	591	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
2Y8K_A	3.61e-19	539	680	336	479	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],5LA0_A Chain A, Carbohydrate binding family 6 [Acetivibrio thermocellus JW20],5LA1_A Chain A, Carbohydrate binding family 6 [Acetivibrio thermocellus JW20]
5LA2_A	3.61e-19	539	680	336	479	ChainA, Carbohydrate binding family 6 [Acetivibrio thermocellus],5LA2_B Chain B, Carbohydrate binding family 6 [Acetivibrio thermocellus]
3SGG_A	7.22e-17	29	404	45	400	Crystalstructure of a putative hydrolase (BT_2193) from Bacteroides thetaiotaomicron VPI-5482 at 1.25 A resolution [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000449	0.998837	0.000210	0.000165	0.000152	0.000146

TMHMM  Annotations     

start	end
5	27