CAZyme Information: MGYG000003282_02084

Basic Information

• Species: Coprobacter sp900545915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter sp900545915
• CAZyme ID: MGYG000003282_02084
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1211		137587.12	6.6145

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003282	3080391	MAG	United States	North America

• Gene Location: Start: 17619; End: 21254 Strand: +

Full Sequence      

MQTHLRTLGLGLALSFGLGQLSAQNGVFKEDFATDGMTLKTIGRGDCHVKNGVFSSRESY
ALFGNPEWKNYSVTFKARAPKGSEQVQIWAGFRAYNRNDRYIIGLKGGLQDDIVLARQGY
MGTDEFFAVKPLGFHPIPGEWYKFKIDVVGDRIRVYINDENIPRIDVTDKNSNLAPSGQV
ALGGGWLTTEFDDLEIKELPENYFQGKKRQEYKYAMTPAEKEAKRQKERSRYKAIEVGTL
NPGRTEISLDGQWLFMPEYQLSDQAKAINPAVEDTDWHSMSVPNFWNPIRIWLHGETFGP
EHYSKGVSDTYFQQETERCENYTFEYGKVKAAWYRQWIELPESIEGKQVELHFDAVSKVA
DVFINGKEAGSHIGMFGDFSVDATPYLKPGKNLIVVKVVRDFIKNIADADKIVDVAVTVP
VTNKMLKDIAHGFYCIDNGGIWQPVQMVITDPVKIEDVFIKPSLTGADYEITLKNYGKKK
QSFDINGKIIDKSNNVQLSDVLLQKGVTLNPGEEKTVMASVKGLQPKLWTPQHPNLYNFK
FSLSNKKGAIDSKTITSGFRTFEKRDDGFLYLNGERYWLRGGNHTVFALTPNDRRMADTF
YQIMKSGNIETTRTHTTPYNELWITAADENGIGISHEGTWPWLMIQSSMPDQNLIDMWAD
EYVGMLKKYRNHPSIFFWTINNEMKFYDNDPDKDRAIKKMQIIEKVVKRMREIDPTRPIC
FDSNYKRPEKRFGKDFFKTFDDGDIDDDHSYINWYDHTVFKQFNGEFQKNKREGRPLISQ
EMSTGYPNNETGHPTTFYTYVHQNPQVLVGDDAYPYGDPNAFLEAHRFITAELAEALRRS
NPEASGILHFALLTWFRNVYDANTIDPYPAYYSMQNSLNPLLVSAELWGRHLYAGSTLPV
RFCVVNDLEDGSTIPASTITWSLVSAGQVLAKGNVDVPVVKHYGRQWMTANINVPSDLPE
SRVDAKLKLELKDKGGVLLSQNDYNITLATQEWSNNEELKDKKIVLVDNNNTAKVFDQLQ
IPYTKVATVTEAVKAKADLYVYAGLDDKNCSAEELSNARKSVQGGKNALFLNCEKAMLKM
YPEHFTGFLVPTEGDIATMEVPESPVFDNIEKMDLRYFNNNKREIPTVCSASMQTVRSEK
VVPLAAQMKIHGYINGDMHKRSEYVSTIKGFPLLMIQDQGKVMVSTMRTDKAATDPIAGK
LLSNMVSTMLK

Enzyme Prediction     

No EC number prediction in MGYG000003282_02084.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	231	1023	1.2e-84	0.7965425531914894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	7.76e-39	241	719	7	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	4.12e-27	332	721	67	447	beta-D-glucuronidase; Provisional
PRK10340	ebgA	8.69e-23	249	717	44	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	1.80e-13	453	560	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	2.94e-13	248	400	3	135	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBN17892.1	0.0	12	1210	11	1204
ALJ60854.1	0.0	28	1211	26	1229
QUT88128.1	0.0	28	1211	26	1229
QDO68995.1	0.0	28	1211	26	1229
QIU96993.1	0.0	15	1209	15	1228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GM8_A	1.74e-26	258	745	14	445	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6ED1_A	1.63e-24	235	755	11	485	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
4YPJ_A	4.39e-24	243	730	6	450	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6SD0_A	1.04e-23	247	732	40	477	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	1.04e-23	247	732	39	476	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	7.42e-32	244	726	51	473	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	2.18e-31	243	690	2	394	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	4.16e-23	244	729	46	462	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q56307	5.69e-23	247	732	40	477	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	2.81e-22	232	683	41	481	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000263	0.999030	0.000223	0.000158	0.000148	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003282_02084.