CAZyme Information: MGYG000003283_00005

Basic Information

• Species: 51-20 sp900762565
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; 51-20; 51-20 sp900762565
• CAZyme ID: MGYG000003283_00005
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		38056.42	9.0258

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003283	1475140	MAG	United States	North America

• Gene Location: Start: 3764; End: 4741 Strand: +

Full Sequence      

MSIPKIIHYFYDDADVWEKGKNPHFRMCLCSWKRCCPDYTLMLWHDKHPEFQKILKHSLF
ARKAYELKLWAFVADYVRLYALYKYGGIYLDTDVELLNNFDAFLNDGFFCSIEGDILNRE
NVPEPAVMGCTAGHPLLKTAMSLYEDNKIFEQENPIANVMLKTALQKTNGFSRILFDTPE
AGAQAEALYAGRRRFDDFMLYLKQKVFRDDKNKISIYPSEYFCPTWCVFKEKAITSRTVA
VHWNQSSWWKKDVFGLLRNSICPQTEPHAEDRITYKICRIPVLKIIRRAALAKYCFLGVF
RLKKTPLCLKFYLGFIPVFKVARSG

Enzyme Prediction     

No EC number prediction in MGYG000003283_00005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	25	105	4.2e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	8.02e-18	3	163	82	231	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.49e-13	31	101	10	84	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ45275.1	7.62e-34	3	248	2	202
QDH55533.1	9.86e-33	3	254	2	222
QCQ32614.1	1.06e-31	2	156	3	150
QCQ41438.1	1.06e-31	2	156	3	150
QKH84134.1	1.06e-31	2	156	3	150

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	8.96e-06	2	137	56	181	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003283_00005.