CAZyme Information: MGYG000003283_00552

Basic Information

• Species: 51-20 sp900762565
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; 51-20; 51-20 sp900762565
• CAZyme ID: MGYG000003283_00552
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613		71122.15	9.0655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003283	1475140	MAG	United States	North America

• Gene Location: Start: 44736; End: 46577 Strand: -

Full Sequence      

MQLIQKKYKKKRLKTYFCGIKISTRKFVYKVPSVPPEHDDKELSLSVVVPVYNAFDELKR
LISSIEKASFSSRTEIIFINDCSTDTRISDYLQNLPAEKYKVIQNRKNLGFIKTCNKGIK
RSKGDIVVLLNSDTEIPDIFEQNIIRCFKSDKNIAIASPIASHSGWWELPCSGDELASMA
RDIDAHSEHSYPPFTPEGLCLCCRRKVLSKIGLLDEIFGRGYCEEDDLVMRAIIAGYRTV
LIDDLFVLHKRHASFSSEGRKKLYEHNRKIFAKRYNDLQGIIRKEMKCTETVAKLTKKID
KNGGGNACLKDDKLIRYAVQLIKWYQYITKKDIDLDNPQTFNEKIQWLKLYDSSPVKTAL
ADKYLVRNWIEKKIGGNCLIPLLGVYDKFEDIDFDTLPRQFVIKCNHGSGYNIIVQDKSK
INPDKIKAQITTWLHENFAFHAGCELHYRDITPKIVIEKYLDEISNSIYDYRFLCMDGRV
EQIWVDINSGTPEHKRNVYDPKWNKLNITVKWPRLETEIAKPDNLDTMINYAQKLSQGFC
FVRVDFYNVNNHIYFGEMTFTSMSGVGQFSSPDEDLRLGQKLQLPGLAWHIDKKKYFILP
KNFHNKLPLSEKL

Enzyme Prediction     

No EC number prediction in MGYG000003283_00552.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	46	168	6.7e-21	0.7294117647058823

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14305	ATPgrasp_TupA	1.79e-56	343	583	1	241	TupA-like ATPgrasp. A member of the ATP-grasp fold predicted to be involved in the biosynthesis of cell surface polysaccharides such as the O-antigen in proteobacteria, the capsule in firmicutes and the polyglutamate chain of teichuronopeptide.
COG1216	GT2	9.54e-28	41	287	1	259	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	8.54e-27	47	251	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	3.17e-18	46	165	1	120	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.53e-17	47	242	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10660.1	1.65e-167	1	305	1	304
AOR38033.1	9.69e-59	36	299	11	277
ACM59219.1	8.84e-41	42	262	438	671
BAZ45973.1	4.71e-39	44	283	851	1099
AKB71855.1	7.25e-37	39	277	627	874

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MLZ_A	4.28e-09	41	158	21	138	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]
5HEA_A	2.76e-06	39	146	2	107	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9D4M9	4.69e-07	46	268	118	351	Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5 OS=Mus musculus OX=10090 GN=Galntl5 PE=1 SV=2
P11290	3.43e-06	45	155	8	118	Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003283_00552.