CAZyme Information: MGYG000003283_00583

Basic Information

• Species: 51-20 sp900762565
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; 51-20; 51-20 sp900762565
• CAZyme ID: MGYG000003283_00583
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000003283_16|CGC1	37800.37	6.4101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003283	1475140	MAG	United States	North America

• Gene Location: Start: 79300; End: 80331 Strand: +

Full Sequence      

MTAALIVSVSGLKLDEEERRLLEKMQPAGVSLFGRNIADKKQLSSLVAEIKKIAGDDVLI
AVDQEGGRVRRLAEPHWRGYASQFVLGQLPDDVCRMHALLIAEELHECGINFNYAPVLDT
VYPQTHEVLRSRCFSHGAAEKGRIMIETYSANGICPCMKHMPGHGRAQTDPHLGLPVIDC
SLAELQRDIRPFRANNTAPAGMTAHIVIPEADNLPVTMSSKAIREVIRGAADFDGLLISD
AIDMGALSGSVAARAEKALAAGCDLVCYCGGKKDELRELAALNIRTDENCLRRLDRVKKI
ISRRQKDFADYELYRQAVGQVNPYAESYDATEVLNLMTEKRTE

Enzyme Prediction     

No EC number prediction in MGYG000003283_00583.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	57	267	4.7e-33	0.9490740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.90e-60	4	298	7	312	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	2.48e-48	5	321	4	329	beta-hexosaminidase; Provisional
pfam00933	Glyco_hydro_3	9.58e-36	5	265	10	281	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10689.1	4.90e-187	1	337	1	337
BBU62584.1	1.63e-69	1	280	1	291
ATQ67523.1	4.59e-69	1	280	1	291
ATG46562.1	7.67e-69	4	282	5	293
AMN41866.1	1.99e-68	4	316	5	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5G1M_A	4.01e-41	1	282	21	308	Crystalstructure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G1M_B Crystal structure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G2M_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G2M_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G3R_A Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G3R_B Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G5K_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5G5K_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
5G5U_A	1.14e-39	1	282	21	308	Crystalstructure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G5U_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_A Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G6T_B Crystal structure of Zn-containing NagZ H174A mutant from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5LY7_A Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5LY7_B Crystal structure of NagZ H174A mutant from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]
3TEV_A	2.26e-38	5	289	22	313	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
7VI6_A	7.54e-38	6	300	5	306	ChainA, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI6_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_A Chain A, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
4G6C_A	1.16e-36	6	298	15	319	Crystalstructure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315],4G6C_B Crystal structure of beta-hexosaminidase 1 from Burkholderia cenocepacia J2315 [Burkholderia cenocepacia J2315]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2KXM7	3.34e-44	6	269	16	293	Beta-hexosaminidase OS=Bordetella avium (strain 197N) OX=360910 GN=nagZ PE=3 SV=1
Q7VWV8	2.93e-41	6	269	17	294	Beta-hexosaminidase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) OX=257313 GN=nagZ PE=3 SV=1
Q7WH65	3.00e-41	6	269	17	294	Beta-hexosaminidase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=nagZ PE=3 SV=1
Q7W9J5	3.00e-41	6	269	17	294	Beta-hexosaminidase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=nagZ PE=3 SV=2
Q02PG9	1.40e-40	1	282	1	288	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003283_00583.