CAZyme Information: MGYG000003283_01076

Basic Information

• Species: 51-20 sp900762565
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; 51-20; 51-20 sp900762565
• CAZyme ID: MGYG000003283_01076
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		48245.01	9.4768

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003283	1475140	MAG	United States	North America

• Gene Location: Start: 9893; End: 11161 Strand: +

Full Sequence      

MFIKIYNTLIRVLYPLVISRYIKKRKAAGKEDLKRFNERVGRPSKARPEGKLFWFHGASV
GESLSMLPLINRVLDTYPQAHVMVTTGTLTSAELMGKRLPERAFHQYLPIDNPVFTTRFV
KHWQPDAVLWFESDLWPAMLSSIKRKNIPLILVNGRISNKSFKRWQQFDFVCKELLSCFT
FCLGQSDEDAYRLRVLGAREAICLGNVKYAGLPLPVDEEKKAEIEKQINGRTVWLASSTH
DDEEFKIAKFHNELKKDFPDLLLLSAPRHPHRGVEIQERLQKELGLKVALRSKNEPIRPD
TDVYVADTIGELGIWYGICPLVFIGGSLIPHGGQNFMEPSRCRDAVIVGPHMHNFTDAMN
RAKKADAVIQVNDVLDLTDNVRQLLGNKELLEAKRSLAYNWAMSEAKVLDGIMDKVRSYM
PE

Enzyme Prediction     

No EC number prediction in MGYG000003283_01076.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	34	209	5.3e-59	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	4.41e-152	1	421	1	422	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	5.06e-142	6	419	5	418	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam04413	Glycos_transf_N	5.97e-69	38	210	2	175	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCQ74891.1	2.81e-134	1	416	1	414
AVM76567.1	2.79e-119	17	420	16	414
AVM72664.1	2.79e-119	17	420	16	414
CDK97342.1	1.59e-118	17	420	16	414
AUG51867.1	1.88e-116	6	416	7	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	6.75e-28	54	394	44	353	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	6.03e-19	219	422	28	233	ChainA, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8VZA5	2.33e-74	4	392	9	406	Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KDTA PE=2 SV=1
Q4UND5	3.65e-74	43	420	88	464	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=waaA PE=3 SV=1
Q68XV7	2.08e-72	52	421	94	462	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=waaA PE=3 SV=1
Q92JE9	6.09e-72	43	420	88	464	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=waaA PE=3 SV=1
Q9ZE58	2.59e-69	52	421	92	461	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995632	0.004155	0.000129	0.000031	0.000013	0.000034

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003283_01076.