CAZyme Information: MGYG000003285_00709

Basic Information

• Species: CAG-495 sp900762585
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp900762585
• CAZyme ID: MGYG000003285_00709
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 2D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		68483.49	10.0634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003285	1711797	MAG	United States	North America

• Gene Location: Start: 18216; End: 20039 Strand: -

Full Sequence      

MNRGKDKSVAKKTKTKKNQRKTKKRESKQRLKKYSILIKFFLLLVITFGLYIAWCFATLP
DIEKAIARTRQPSTSIIAENGNEIQSFGSVYSEVVPLEELPPFLPDAVVATEDRRFYSHF
GFDAISFTRAMLVNLWHRRYVQGGSTITQQVAKNLFLTPNKNIKRKVQELLLAFWLEHKL
TKEQILTLYLNRVYLGAGTYGIEAASQKYFQKSSRDVNLMEAAIIGGMLKAPSRYNPQAS
ETRARERAAVVLDNMVKNDKISESQRQSALKMKLGPEKSYKIEGGKYFADWVYRDVNDYI
GERDNDIYVATTLDQNLQNRAEKVLAASVKANAWRNITNGAVVIMDYTGAVKAMVGGVNY
NKSQFNRAVQALRQPGSSFKPFVYLTALENGFSPNDTIDDYPINLNGWKPENYDKKYYGQ
VSLKEALAKSLNLATINLSEKVGRSKIIRNARRMGISTPISNTPSLALGTFEVKVLDMAV
AYTSIANGGYAVWPYAIQEIYTKDGYQLYMREPDEPNRIIEDYAAEEMRDMLERVINSGT
GKKAKLPFFAAGKTGTSQDYRDAWFVGFTDKYVAAVWVGNDNNSPMKGVTGGNVPAEIWK
QIMQVAV

Enzyme Prediction     

No EC number prediction in MGYG000003285_00709.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	81	256	2.7e-66	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	0.0	93	606	3	528	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	0.0	17	606	1	596	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.33e-170	30	606	3	718	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	3.35e-128	95	604	150	680	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
TIGR02073	PBP_1c	5.96e-119	70	602	8	539	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR98160.1	1.46e-275	7	603	12	611
QEX14746.1	2.06e-182	51	607	50	608
QEX20106.1	1.71e-181	51	607	50	608
CCQ72024.1	9.72e-181	52	604	13	568
QQP92621.1	2.21e-180	59	606	85	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	3.23e-82	76	607	23	723	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	2.86e-74	84	607	31	716	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
5FGZ_A	1.41e-72	95	587	159	675	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	2.00e-72	95	587	180	696	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3FWL_A	3.74e-68	95	587	163	679	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O66874	2.28e-98	56	605	27	666	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P45345	1.12e-89	95	603	171	701	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1
P0A0Z5	2.26e-88	59	607	35	706	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1
P0A0Z6	2.26e-88	59	607	35	706	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
Q5FAC7	3.16e-88	43	607	5	706	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999958	0.000075	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
34	56