CAZyme Information: MGYG000003287_00596

Basic Information

• Species: Prevotella melaninogenica
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella melaninogenica
• CAZyme ID: MGYG000003287_00596
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
861	MGYG000003287_28|CGC1	97513.89	6.5774

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003287	3259243	MAG	United States	North America

• Gene Location: Start: 14946; End: 17531 Strand: +

Full Sequence      

MKQKKLLVTFALGMCALTAAHAQDNDFDLGSQRSEVQLVNPVPGKKIDHQGLVINPTPRY
VKLTGEGTVDISGGVKLDQPQPARKQSWDYWTDLNFLSRADKGFPMKIQLVKIPVVLDKI
GQSDATTDGAYTLRITKKGITLLAAYDLGVFYGIQTLRQIMENPSVEGGKKLPCLEINDA
PVFAYRGVVEGFYGTPWSHAVRLSLIDFYGKYKMNTYIYGPKDDPYHSSPNWRLPYPENE
MKDIKELVAACKKNRVDFVWAIHPGKDIKWNEEDYQNLMHKLDLMYQAGVKSFAIFFDDI
SGEGTNPNRQVELLNRLTKEFVKAKGDVAPLIICPTDYSKLWAKADENGPLSIYGKTLNP
SVRVFWTGDVVCSDVTKSTLDWVDSRIKRPAFFWWNYAVTDYVRNLVLQGPVYGLDTSLT
DKDMCGLVSNPMEHGEASKLSLYSVADYTWNPSDYNPIDSWERGLEVMMPRAKEAYRTFA
IHSADTETGYRRDESWETETFRLADYSKEKRDKLYQEFERVAKAPAEIEAGCTDNLLMKE
LKPWLTEFAKLGERGKSAIELMDLYRSGDNLKFWSKYVKSRMSAEDKKAYEAHKSGTMKL
QPFYDFAMDDLGDAFYEKLSGEKAFTLRGIGSYKNLKTTQAGLMFDGDSITHYTSGEAQK
AGDWMGVALPEPMAVREVHILQGRNSTDDCDFYDHAALEYSVDGKTWNTMLGDMKNQYDI
LWQGDPVQARYIRLRRLDSDRKNWASIRSFVVVPAGAASLEFENSKAGSSDVLLAFDHQP
GTSFKNTGAVSFEVPRGMTSYTFMLSLPEGGSVRVCQYDKRNKLKAEFTSNEPFFTVDVA
KKVTRMELIGKAEVFEIIPKK

Enzyme Prediction     

No EC number prediction in MGYG000003287_00596.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	186	480	1.3e-107	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	4.55e-164	186	479	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	4.12e-13	56	179	6	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	1.65e-07	54	244	136	320	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	8.66e-06	641	750	14	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	4.37e-04	617	748	1	138	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB58693.1	0.0	1	861	1	861
QUB56101.1	0.0	1	861	1	861
QUB61419.1	0.0	1	861	1	861
QUB68090.1	0.0	1	861	1	861
QUB74291.1	0.0	1	861	1	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2J4G_A	5.54e-148	131	752	80	710	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
5MI4_A	5.60e-148	131	752	92	722	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	5.70e-148	131	752	81	711	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2JIW_A	5.70e-148	131	752	81	711	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	6.23e-148	131	752	84	714	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	5.78e-147	131	752	102	732	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	8.10e-89	36	562	28	572	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	2.12e-88	36	562	28	572	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	8.32e-48	151	752	154	794	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	4.10e-36	187	458	63	339	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000337	0.998047	0.000965	0.000232	0.000201	0.000180

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003287_00596.