CAZyme Information: MGYG000003287_01356

Basic Information

• Species: Prevotella melaninogenica
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella melaninogenica
• CAZyme ID: MGYG000003287_01356
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	MGYG000003287_66|CGC1	48311.95	5.9027

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003287	3259243	MAG	United States	North America

• Gene Location: Start: 20709; End: 22007 Strand: +

Full Sequence      

MEMMSAVRPLETFVPPRAAGQRDVLSLALPPMPLLRVAFVGVGARGRMAVTRWCHIPKVE
IAAVCDVSKEVTEEVARHVEQLGKPRPKVYWGETAYKDLCQQQGVNLVYVCTDWMSHVPI
AIHAMEQGRSVAVEVPAALTLKDIWALIDTAEQTRQHCMMLENAVYDRFEMAVCQMVHEG
LLGELVHVEGGYAHPIGDRWTPWRMEYSRLNAGDVYPTHSIGPVCRLLDIHRTDRMHYLT
AMQTNAFLGTEMYQVVMGKACDSFANGDQTSTMIRTVKGKTMLIQHNVMTPRPYSRMFQA
VGTAGYAAKYPVPEVQLSPEMAAKVGIEMEDEKLPLNASQIETLLNHYAPSFPSETIALA
KELDARGGMSYFMDLRLAQCLQQGLPLDMDVYDLAEWCCVAELSKRSIEQGSMPVMIPDF
VNRKASVDTESI

Enzyme Prediction     

No EC number prediction in MGYG000003287_01356.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	32	422	3.2e-137	0.9774436090225563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	6.50e-19	32	240	1	194	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.85e-11	35	163	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	8.83e-04	97	204	57	164	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB59230.1	0.0	1	432	1	432
QUB57031.1	0.0	1	432	1	432
QUB67285.1	0.0	1	432	1	432
ASE18888.1	0.0	1	432	1	432
ADK97129.1	0.0	1	432	3	434

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	4.74e-72	16	420	24	433	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	6.16e-52	35	424	21	430	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E18_A	2.19e-12	36	372	7	308	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3HNP_A	1.56e-06	35	189	3	150	CrystalStructure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_B Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_C Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_D Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_E Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579],3HNP_F Crystal Structure of an Oxidoreductase from Bacillus cereus. Northeast Structural Genomics Consortium target id BcR251 [Bacillus cereus ATCC 14579]
3E82_A	2.14e-06	35	202	8	160	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C863	3.30e-145	7	420	26	447	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q5LGZ0	3.30e-145	7	420	26	447	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
Q89ZX8	6.78e-143	9	420	31	450	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q7MWF4	4.22e-139	4	420	27	451	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2
A6KX96	4.65e-139	9	420	35	454	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003287_01356.