CAZyme Information: MGYG000003287_02362

Basic Information

• Species: Prevotella melaninogenica
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella melaninogenica
• CAZyme ID: MGYG000003287_02362
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000003287_123|CGC1	36890.24	9.9351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003287	3259243	MAG	United States	North America

• Gene Location: Start: 2143; End: 3096 Strand: -

Full Sequence      

MKRYIFLFISFLYMFSTVASGQARWNQVYQSYIDQYKDMAIEGMLKYGVPASITLAQGLL
ESGAGRGRLVLLGNNHFGIKCHGWLGRTISHDDDAKGECFRAYDSALESFEDHCKFLRDR
PRYRSLFSLDRSDYRGWAYGLKRAGYATNPVYAQSLINLIELYKLYEYDKAKSYDRFMAH
HSGENSVVRGIENGRPNPVQVLGAHPINKYNDNYYVIVRQGDSFKSLSKELEISVGKLAK
YNERDKHERLIPGEYIWLKKKQKKGPKEFKKRPYYVRKSESLYDIAQRYGIRLKSLVKKN
EKIAERGLRIGDEVILY

Enzyme Prediction     

No EC number prediction in MGYG000003287_02362.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	38	165	5.6e-31	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	9.29e-37	16	174	30	193	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	4.79e-36	30	169	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	3.80e-26	24	175	3	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	9.14e-25	37	165	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12709	flgJ	3.71e-20	48	161	192	317	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB57960.1	5.27e-234	1	317	1	317
QKH88934.1	5.27e-234	1	317	1	317
QUB56633.1	5.27e-234	1	317	1	317
ADK95534.1	2.14e-233	1	317	1	317
ASE17433.1	2.14e-233	1	317	1	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	5.09e-12	30	160	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	6.07e-12	30	160	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	3.98e-11	30	160	3	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	3.82e-09	30	169	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	8.62e-13	30	170	49	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	1.49e-12	30	159	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	7.00e-10	31	159	163	302	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P58231	2.76e-09	48	174	168	305	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	2.76e-09	48	174	168	305	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000243	0.999140	0.000162	0.000150	0.000141	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003287_02362.