CAZyme Information: MGYG000003288_01470

Basic Information

• Species: Duodenibacillus sp900544255
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Duodenibacillus; Duodenibacillus sp900544255
• CAZyme ID: MGYG000003288_01470
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000003288_84|CGC1	39259.84	9.9238

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003288	2215926	MAG	Mongolia	Asia

• Gene Location: Start: 47529; End: 48638 Strand: +

Full Sequence      

MSEEAKHLVIAAAGTGGHVFPALAVARELLARGWKVTWIGTKTGMEGGLIAKSAPEIDFV
PLDFRGVRGKGLFGAVTGVIKLFKATVKSKQLMRDLKPDVFFTTGGYIAVPVNNGAKKNH
VRTVIMNCDADLLMSTEMILRDAWAVACGFAGSARSRAASKGYITGNPVRREIEAVPSPE
ERLAGRSGPLKLLVFGGSLGAQVLNETVPKALALFEEDKRPQVLHQCGAKQIEAAKKCYA
DAGVKADVVGFIDDMAAAYRDADLVICRSGATTAAELCASGSAAVMVPFVVKTTQHQMGN
ARYLASRGAGILLEQAHLTPEHLFGLLASIKREKILDMAVKARGLMKPHAAQTVADLIET
VRGMKEKPV

Enzyme Prediction     

No EC number prediction in MGYG000003288_01470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	192	350	1.1e-46	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	2.33e-134	6	361	2	354	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.52e-114	7	357	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	6.99e-105	8	359	3	352	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	9.71e-95	6	358	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	5.26e-39	192	354	2	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA55069.1	1.01e-139	8	366	13	369
QQS89342.1	2.60e-136	4	361	12	367
BBF22505.1	1.15e-133	6	359	7	358
QQQ95911.1	9.42e-127	6	361	3	356
ANU67058.1	9.42e-127	6	361	3	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	3.72e-75	6	359	10	363	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	5.69e-74	1	361	2	353	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	3.74e-65	7	365	4	359	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1GZ01	7.38e-104	6	361	3	358	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=murG PE=3 SV=1
A2SCY5	4.40e-97	6	359	4	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1) OX=420662 GN=murG PE=3 SV=1
Q7NPZ9	8.03e-96	6	363	4	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=murG PE=3 SV=1
A6T2F8	2.42e-94	6	359	2	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Janthinobacterium sp. (strain Marseille) OX=375286 GN=murG PE=3 SV=1
A4G8T8	3.89e-93	6	359	2	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Herminiimonas arsenicoxydans OX=204773 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003288_01470.