CAZyme Information: MGYG000003289_00115

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae
• CAZyme ID: MGYG000003289_00115
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245		28576.63	7.8414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003289	1111568	MAG	Mongolia	Asia

• Gene Location: Start: 16; End: 753 Strand: -

Full Sequence      

MSIPKKIHYCWFGNAPLPRSAERCIASWRKHCPEYEIIRWDESNLNLKENLYASQAYEAK
KWAFVSDYFRLKIVYEQGGVYLDTDVELLCSLDALTEQYDGFFGYENDTMIATGLGFGAA
AGNRFVQAMLEAYRDIPFALGENQYDETPCPRRNTDALLRLGLDPAIKNQVIDRVCFLEE
NVLCPLSFFTGKKNITEKTISIHHYNSSWCSDVTRRTKRLKRLIGVKNYDFLYGKFLHKS
KRWEW

Enzyme Prediction     

No EC number prediction in MGYG000003289_00115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	22	98	3.2e-22	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.90e-23	3	133	82	214	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.13e-13	23	102	6	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.48e-07	3	135	46	190	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31225.1	2.30e-79	3	225	2	225
AYV37964.1	7.34e-74	1	239	1	238
ACD37145.1	2.08e-70	3	239	2	237
QGH87046.1	2.08e-70	3	239	2	237
BAQ02241.1	2.08e-70	3	239	2	237

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ZU30	4.26e-06	3	102	28	151	Subversion of eukaryotic traffic protein A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=setA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003289_00115.