CAZyme Information: MGYG000003290_00353

Basic Information

• Species: CAG-475 sp900763875
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; CAG-475; CAG-475 sp900763875
• CAZyme ID: MGYG000003290_00353
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815		90184.03	7.5832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003290	1530447	MAG	Mongolia	Asia

• Gene Location: Start: 5764; End: 8211 Strand: +

Full Sequence      

MNDKDYMEILKKLTLDEKVTMLCGSTNWLTQPIKRDDIDIPAVRMSDGPSGLRREKIGGG
VNIMQTPEPATCFPGAVTTASSWDVELVEEVGKAIAVEAQSLGVSTVLGPGVNIKRGPLC
GRNFEYFSEDPFLAGRMGGAWVHGVQKMNVGTSLKHYLANNQEYIRMTIDSIVDERTLRE
IYMPAFEYIVKEEQPTTVMCSYNRLNGTYLSDHKRFLTDVLRDEWGFKGIVVSDWGAVNN
RAEGVKAGLDLEMPGSKGCGLNGDTVYNALKDGTLSEEDIDKVVLRLIKFAYENTVREVE
GIKFDVDKHDEIARKAAEGGAVLLKNDGILPLNKKQSIAVVGRLAKQIRYQGGGSSHILP
TRLTSFTDALDKAGQAYDYADGYVLKGEGYRKNLVKKAVKAAKGKDVVLLFVGLTDAFES
EGYDRHHIKMPSSHVTLINEILKVNKNVVVVLSCGSPVEIGDWDKDVKGILNLYLGGQAG
GAAAYNLIYGKVNPSGKLAETFPVHEDDYLGSKYFRMGPRTVEYREGIYVGYRYYDSAKK
RVKYPFGYGLSYTQFEYSNLRLSANAINEGEPLTVTFTVKNVGKTAGAEIAQLYVGDVES
TLYRPAKELKGFKKVFLQPGEEQDVEISLDSRAFAYYNVAINDWHVESGDFKILVGTSSR
DIKLEGVVNVTSSNPDAQIPDYKEVAPCYYDIANATEIPTQQFEALYGAKMIENKPFAKG
ELQACNTIGQCRVSPFGKFMYNLCVGAVNLVALSSENPEMLTNSVKDMPYRTIAAWSMGL
ISKRSLDGLVDMLNGKKGGFRRFLKGFRKEKPKKK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.37	3.2.1.23	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	254	2.2e-67	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	9.16e-85	8	663	40	758	beta-glucosidase BglX.
COG1472	BglX	3.33e-67	40	356	60	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	9.83e-57	13	630	60	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	3.17e-39	35	288	49	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.39e-35	321	532	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV59720.1	2.19e-235	9	795	19	803
QEN03854.1	3.83e-228	4	807	3	800
CAJ35242.1	2.80e-226	4	796	2	795
CEP78497.1	7.33e-220	3	673	2	666
AGS53344.1	8.54e-220	8	796	5	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	5.99e-212	5	794	4	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.11e-175	1	670	1	663	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.71e-124	8	670	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.01e-122	8	670	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	7.35e-99	1	662	1	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	5.80e-212	5	794	4	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	3.72e-178	1	662	1	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	9.22e-176	1	662	1	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q2U8Y5	2.77e-108	5	663	5	825	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
B8NDE2	7.54e-108	5	663	5	825	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003290_00353.