CAZyme Information: MGYG000003291_00663

Basic Information

• Species: Faecalibacterium prausnitzii_M
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_M
• CAZyme ID: MGYG000003291_00663
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	MGYG000003291_112|CGC1	57198.1	5.1205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003291	2081808	MAG	Mongolia	Asia

• Gene Location: Start: 14110; End: 15666 Strand: -

Full Sequence      

MNLSLVRSMTRSAVFELENGLCYRPAHPFTVTLDGVTVYESCNTNVFSLFSLLPGTTYTL
GVQAEGETLSLTFTTEAETFFVDASRYGLVADGTTDNTVRLQAALSTCPKGGTVYVPAGR
YRTASLFMKSCTTLYLEKGAVLLGDNDRTHYPILPGVLPCQNEVDEYYLTGWEGNPLDSF
AGLLNITQVHDVVVTGEGTLDCDAQNGDWWVDPKVKRIAWRPRAVAAVDSENVCLHGITV
QNSYSWTIHPIFVKHLDLLNFNINNPYNAPNTDGIDPESCQYTRIIGVNIHVGDDCIAMK
ASKIFLGMKLKKSCEHTVIRNCLLDKGHGGIVIGSEMSGGVKDMVVTQCLMDHTDRGLRV
KTRRGRGNTAVIDGLVFRNVEMRGVKAPFVINMFYFCDPDGHGPYVQCREALPVDEYTPK
LGSLTMEDIVATDAQFAGCYFDGLPEQPIEKVTMKNVTITFDPDAKEGQAAMADNRPLVK
KLALYAENVKEIVLHNVKIEGYEGERLHFANVGHFEED

Enzyme Prediction     

No EC number prediction in MGYG000003291_00663.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	106	466	1.7e-69	0.9261538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	3.08e-89	74	501	75	532	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	1.01e-25	172	463	41	307	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	1.66e-18	51	459	43	408	polygalacturonase ADPG
PLN02793	PLN02793	7.83e-16	244	398	197	342	Probable polygalacturonase
PLN02188	PLN02188	1.26e-15	77	413	32	331	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL00656.1	0.0	1	518	1	518
AXB29658.1	0.0	1	518	1	518
CBK99742.1	0.0	1	518	1	518
AXA82452.1	0.0	1	518	1	518
ATP00558.1	0.0	1	518	1	518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	3.01e-34	87	459	33	410	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	9.97e-27	87	497	50	446	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	7.10e-24	47	428	115	531	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	1.79e-21	89	462	18	364	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
4C2L_A	3.34e-08	92	400	26	309	Crystalstructure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	1.32e-50	223	489	23	292	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	3.78e-44	87	467	68	432	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	1.56e-24	52	428	115	524	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P18192	1.61e-21	89	462	44	390	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
P26509	1.29e-20	89	462	44	390	Endo-polygalacturonase OS=Pectobacterium parmentieri OX=1905730 GN=pehA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003291_00663.