CAZyme Information: MGYG000003291_00885

Basic Information

• Species: Faecalibacterium prausnitzii_M
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_M
• CAZyme ID: MGYG000003291_00885
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		34406.59	5.2421

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003291	2081808	MAG	Mongolia	Asia

• Gene Location: Start: 14350; End: 15297 Strand: -

Full Sequence      

MLTIHVEQDGSAHFTTISEAVLAVPYDCPAEIRIGAGVYREKLVCEKKDITLIGAGADRT
RLVWGDGGKVPHPDGRIYHTFRSYTAFFSGEKLRVQDMTIENDAGPGAKVGQAVAAYVDS
SRAEFYSVRLLGNQDTLFCAPLPEKEREKDGFLGPRWLSDRKMTVQYYRNCEIAGDIDFI
YGGGDALFEQCTIRTVNNGLPRSYVTAPSGAAEGLGFVFWDCDFVSDNCPAGTVFLGRPW
RPTGRTAVLDSRLGAHISPEGFSPWHDRTDSELAGFAEAGNTGAGAGARGAWVQQLDQKQ
EAELLARARSLCRPE

Enzyme Prediction     

No EC number prediction in MGYG000003291_00885.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	305	3e-77	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	5.16e-53	12	271	92	364	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	4.41e-50	6	265	4	245	Pectinesterase.
PLN02773	PLN02773	2.42e-41	4	276	7	260	pectinesterase
PLN02682	PLN02682	7.64e-40	2	269	69	318	pectinesterase family protein
PLN02745	PLN02745	1.11e-38	6	265	289	530	Putative pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27671.1	1.27e-182	1	315	1	314
CBL01447.1	1.27e-182	1	315	1	314
AXA81880.1	1.19e-172	1	314	1	313
CBK98674.1	7.96e-171	1	314	1	313
QIA44050.1	4.14e-163	1	314	1	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.82e-29	6	290	11	277	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.54e-24	6	287	7	270	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	2.20e-21	9	286	14	311	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	3.86e-21	14	286	44	335	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1C_A	1.68e-17	6	285	13	265	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.93e-32	4	278	7	262	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	9.08e-32	2	306	85	371	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q8GXA1	1.80e-30	6	285	260	522	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
O49298	3.09e-30	6	290	253	512	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q43062	3.36e-30	6	287	211	475	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003291_00885.