CAZyme Information: MGYG000003291_01269

Basic Information

• Species: Faecalibacterium prausnitzii_M
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_M
• CAZyme ID: MGYG000003291_01269
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000003291_212|CGC1	40029.27	8.2937

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003291	2081808	MAG	Mongolia	Asia

• Gene Location: Start: 11095; End: 12222 Strand: +

Full Sequence      

MRVLIAAGGTAGHINPALAIAGALKKADPTAEIHFAGRKEGMEYRLVTQAGYPFHHIEIT
GFQRHLSLHNIKRNIITLWNLALSGPKAKAMMKQVQPDLVIGCGGYVSGPVVRCAAKMGI
HTAIHEQNAFPGVTNKLLAPDVDIVFAAVPAAVEKLGAPAKTTVVGNPVRPEVFTKAKDR
DAIRQQLGAGDRTVILSFGGSLGARRVNQVVADLCAWEQQEHKPVLHLHATGQYGVELFQ
DLEKQKGFAPGDSLVVKEYINNMPELLAAADLVISRAGALTLAELEAVGRAAVLIPSPNV
AENHQYYNAMELQKAGAAVVIEEKDLTGEKLVDTVSALLAQPGKLAQMGKNARSLSVDDS
LDRITAALLELVNKN

Enzyme Prediction     

No EC number prediction in MGYG000003291_01269.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	195	358	1.1e-48	0.9745222929936306

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	2.08e-130	1	374	2	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.98e-127	2	366	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	6.75e-108	1	374	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	9.10e-96	1	368	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	1.09e-43	194	364	1	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL01758.1	8.20e-249	1	372	1	372
AXB27899.1	8.20e-249	1	372	1	372
ATL89938.1	2.51e-243	1	372	1	372
AXA82541.1	5.06e-243	1	372	1	372
CBK99834.1	1.45e-242	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	3.86e-50	2	371	4	354	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	1.30e-45	2	364	8	346	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	8.28e-41	2	353	11	347	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4J2B1	3.08e-83	1	364	1	360	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=murG PE=3 SV=1
A3DE27	1.42e-80	1	372	1	363	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=murG PE=3 SV=1
B8FT56	2.82e-80	1	370	1	365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulfitobacterium hafniense (strain DSM 10664 / DCB-2) OX=272564 GN=murG PE=3 SV=1
Q732F8	3.44e-80	1	374	1	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=murG1 PE=3 SV=1
Q812W5	6.86e-80	1	374	1	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=murG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003291_01269.