CAZyme Information: MGYG000003293_00251

Basic Information

• Species: CAG-110 sp900544405
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900544405
• CAZyme ID: MGYG000003293_00251
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775	MGYG000003293_14|CGC1	84722.67	5.6827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003293	2030729	MAG	Mongolia	Asia

• Gene Location: Start: 682; End: 3009 Strand: -

Full Sequence      

MDIETILQQMTLEDKIALCSGENFWETKKYEKYGIPSLCMCDGPHGLRKQENVADMLGVN
ESRKATCFPAEVTTAGSWDPELLEQIGAAIGQEAREQCVGLVLGPGANLKRNPLCGRNFE
YFSEDPYLAGKLAAGFIRGAEAQGIGTSLKHFAVNSQEKSRFTSNSVLDDRTLRELYLTA
FEIAVKEGKPSTVMCAYPKLNGVHCSDNKALLTDILRTEWGFSGLVVTDWGAMNDRIEGF
RAGCDLNMPGGSDYMEKEVLQAVKDGTLPERCIDDSARRVLKLVFRAAQTLKEKTDCDYE
AHHALAKRAAVEGAVLLKNEGGILPLKKDAKIAVIGAMAKKLRYQGAGSSHINPTKLSQP
LDFLPGTLYAPGCDDRGDTTEDLLSQAAKTAQEAEIAVIFAGLPDRYESEGFDRADMKMP
EGQLRMIDAVAAANPNTVVVLLCGSAVECPWADRVKGILYMGLPGQAGGEAVADLLCGRA
NPSGKLAESWPLSYADVPSSEIYGKTDDALYEEGLYVGYRYYEKSGVAVRWPFGYGLSYT
EFSYSDLTVNGDTVSVTVRNTGKRAGAEVVQLYIRAPQDGLHRPLRELKGFQKVFLQSGE
SRTVTFPLTDRSFAVWQGGWKIPAGKYTVCIGGLTAEVEKSGETLPVPAWQGGSWYERCT
GKPNQTDWEAMLGRTYTPPVLKKGSFTMENTVEEMKDYSLIMKIMYKATEHVIAKGNGGK
IDYENPNFRMQMASSAGGPLRSMMISGGMKGGVLPGMLEMANGNFFRGLWRMIRG

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	30	249	7.6e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	9.75e-97	66	645	118	764	beta-glucosidase BglX.
COG1472	BglX	1.54e-80	34	374	59	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.60e-79	58	638	100	775	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.10e-70	314	519	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.14e-43	34	283	65	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANX00396.1	0.0	10	774	1	746
AGC67350.1	0.0	10	774	1	746
ANW97844.1	0.0	10	774	1	746
AGI38411.1	0.0	10	774	1	746
AGS53403.1	3.58e-235	2	767	4	782

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.56e-230	1	638	3	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.60e-182	7	661	9	687	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.08e-141	3	642	4	709	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.66e-140	3	642	4	709	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	4.68e-114	2	632	5	822	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.40e-229	1	638	3	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.32e-179	7	655	9	690	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	3.31e-177	7	655	9	690	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	6.23e-129	3	638	46	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	2.08e-128	3	639	11	835	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003293_00251.